IR 05000247/2010005: Difference between revisions

From kanterella
Jump to navigation Jump to search
(Created page by program invented by StriderTol)
 
(Created page by program invented by StriderTol)
Line 18: Line 18:


=Text=
=Text=
{{#Wiki_filter: February 11, 20IIMr. Joseph E. PollockSite Vice PresidentEntergy Nuclear OPerations, Inc.Indian Point EnergY Center450 Broadway, GSBBuchanan. NY 1051 1'0249
{{#Wiki_filter:UNITED STATES NUCLEAR REGULATORY COMMISSION REGION I 4T5ALLENDALE ROAD KING OF PRUSSIA, PA 19406-1415 February 11, 20II Mr. Joseph Site Vice President Entergy Nuclear OPerations, Inc.Indian Point EnergY Center 450 Broadway, GSB Buchanan.


SUBJECT: INDIAN POINT NUCLEAR GENEMTING UNIT 2 - NRC ]NTEGMTEDI NSPECTION REPORT 05000247 120 1 0005
NY 1051 1'0249
 
SUBJECT: INDIAN POINT NUCLEAR GENEMTING UNIT 2 - NRC ]NTEGMTED I NSPECTION REPORT 05000247 120 1 0005


==Dear Mr. Pollock:==
==Dear Mr. Pollock:==
On December 31 ,2010, the U.S. Nuclear Regulatory Commission (NRC) completed aninspection at lndian point Nuclear Generating unit z. rne enclosed integrated inspection reportdocuments the inspection results, which wer6 discussed on January 19,2011 with you andother members of Your staff.The inspection examined activities conducted under your license as they relate to safety andcompliance with the Commission's rules and regulations, and with the conditions of yourlicense. The inspectors reviewed selected procedures and records, observed activities, andinterviewed personnel.This report documents four NRC-identified and five self-revealing findings of very low safetysignificance (Green). Additionally, two licensee-identified violations which were determined tonJ oi u"w low safety significance are listed in this report. Six findings were determined toinvolve violations of f.f nlC requirements. However, because of their very low safety significanceand because they are entered into your corrective action program, the_NfC is treating these asnon-cited violations (NCVs) consistbnt with Sectio n 2.3.2 of the NRC Enforcement Policy. lf youcontest these ruCvs) you s'hould provide a response within 30 days of the date of this inspectionreport, with the Oasis ior your denial, to the Nuclear Regulatory Commission,.ATTN': Documentcontrol Desk, washingtoh Dc 20555-0001; with copieJto the Regional Administrator, Region 1;the Director, bffice of Enforcement, United States Nuclear Regulatory Commission,washington, DC 20555-0001; and the NRC Senior Resident lnspector at Indian Point NuclearG"n"r"iing Unit 2. ln addition, if you disagree with the cross-cutting aspect assigned to thefindings inlnis report, you should provide a response within 30 days of the date of thisinspeition report, witnine basis for your disagreement, to the Regional Administrator, Region 1,and the NRC Senior Resident lnspector at lndian Point Nuclear Generating Unit 2.
On December 31 ,2010, the U.S. Nuclear Regulatory Commission (NRC) completed an inspection at lndian point Nuclear Generating unit z. rne enclosed integrated inspection report documents the inspection results, which wer6 discussed on January 19,2011 with you and other members of Your staff.The inspection examined activities conducted under your license as they relate to safety and compliance with the Commission's rules and regulations, and with the conditions of your license. The inspectors reviewed selected procedures and records, observed activities, and interviewed personnel.
 
This report documents four NRC-identified and five self-revealing findings of very low safety significance (Green). Additionally, two licensee-identified violations which were determined to nJ oi u"w low safety significance are listed in this report. Six findings were determined to involve violations of f.f nlC requirements.


J. PollockIn accordance with Title 10 of the Code of Federal Regulations (10 CFR) Part 2.390 of theNRC's "Rules of Practice," a copy of this letter, its enclosure, and your response (if any) will beavailable electronically for public inspection in the NRC Public Document Room of from thePublicly Available Records component of the NRC's document system (ADAMS). ADAMS isaccessible from the NRC Web Site at http://wmv.nrc.oov/readinq{m/adams.html (the PublicElectronic Reading Room).
However, because of their very low safety significance and because they are entered into your corrective action program, the_NfC is treating these as non-cited violations (NCVs) consistbnt with Sectio n 2.3.2 of the NRC Enforcement Policy. lf you contest these ruCvs) you s'hould provide a response within 30 days of the date of this inspection report, with the Oasis ior your denial, to the Nuclear Regulatory Commission,.ATTN':
Document control Desk, washingtoh Dc 20555-0001; with copieJto the Regional Administrator, Region 1;the Director, bffice of Enforcement, United States Nuclear Regulatory Commission, washington, DC 20555-0001; and the NRC Senior Resident lnspector at Indian Point Nuclear G"n"r"iing Unit 2. ln addition, if you disagree with the cross-cutting aspect assigned to the findings inlnis report, you should provide a response within 30 days of the date of this inspeition report, witnine basis for your disagreement, to the Regional Administrator, Region 1, and the NRC Senior Resident lnspector at lndian Point Nuclear Generating Unit 2. In accordance with Title 10 of the Code of Federal Regulations (10 CFR) Part 2.390 of the NRC's "Rules of Practice," a copy of this letter, its enclosure, and your response (if any) will be available electronically for public inspection in the NRC Public Document Room of from the Publicly Available Records component of the NRC's document system (ADAMS). ADAMS is accessible from the NRC Web Site at http://wmv.nrc.oov/readinq{m/adams.html (the Public Electronic Reading Room).


Sincerely,/atN,Mel Gray, ChiefProjects Branch 2Division of Reactor Projects50-247DPR-26f nspection Report No. 050002 47 12010005w/  
Sincerely,/atN, Mel Gray, Chief Projects Branch 2 Division of Reactor Projects 50-247 DPR-26 f nspection Report No. 050002 47 12010005 w/  


===Attachment:===
===Attachment:===
Supplemental InformationDistribution via ListServDocket No.License No.
Supplemental Information Distribution via ListServ Docket No.License No.


===Enclosure:===
===Enclosure:===
Line 36: Line 41:


=SUMMARY OF FINDINGS=
=SUMMARY OF FINDINGS=
lR 0500024712010005i 1010112010 - 1213112010: Indian Point Nuclear Generating (lndianPoint) Unit 2; Post-Maintenance Testing; OccupationalALARA Planning and Controls;ldentification and Resolution of Problems; Event Follow-up; and Other Activities.This report covered a three-month period of inspection by resident and region based inspectors.Six non-cited violations (NCVs) and three findings of very low safety significance (Green) wereidentified. The significance of most findings is indicated by their color (Green, White, Yellow,Red) using lnspection Manual Chapter (lMC) 0609, "Significance Determination Process(SDP)." The cross-cutting aspect for the findings was determined using IMC 0310,"Components within the Cross-Cutting Areas." Findings for which the significance determinationprocess does not apply may be Green, or be assigned a severity level after NRC managementreview. The NRC's program for overseeing safe operation of commercial nuclear powerreactors is described in NUREG-1649, "Reactor Oversight Process," Revision 4, datedDecember 2006.
lR 0500024712010005i 1010112010 - 1213112010:
Indian Point Nuclear Generating (lndian Point) Unit 2; Post-Maintenance Testing; OccupationalALARA Planning and Controls;ldentification and Resolution of Problems;
Event Follow-up; and Other Activities.
 
This report covered a three-month period of inspection by resident and region based inspectors.
 
Six non-cited violations (NCVs) and three findings of very low safety significance (Green) were identified.
 
The significance of most findings is indicated by their color (Green, White, Yellow, Red) using lnspection Manual Chapter (lMC) 0609, "Significance Determination Process (SDP)." The cross-cutting aspect for the findings was determined using IMC 0310,"Components within the Cross-Cutting Areas." Findings for which the significance determination process does not apply may be Green, or be assigned a severity level after NRC management review. The NRC's program for overseeing safe operation of commercial nuclear power reactors is described in NUREG-1649, "Reactor Oversight Process," Revision 4, dated December 2006.
 
===Cornerstone: Initiating===


===Cornerstone: Initiating Events. ===
Events.
: '''Green.'''
: '''Green.'''
A Green self-revealing finding was identified because Entergy's procedure2-lC-PC-N-P-408A, "Main Boiler Feed Pump (MBFP) Discharge Pressure SpeedControl," did not provide adequate guidance to ensure proper settings for the MBFPspeed controller settings at low power operations. Specifically, between May 5, 2006and September 3, 2010, procedure 2-lC-PC-N-P-408A did not provide adequateguidance to ensure proper settings for the MBFP speed controller settings at low poweroperations, resulting in a slow MBFP response, which contributed to a reactor trip from41o/o power. Entergy personneltook immediate corrective actions to change the MBFPspeed controller settings. This issue was entered into Entergy's corrective actionprogram (CAP) as condition report (CR)-lP2-2010-05484.This finding is more than minor because it is associated with the design control attributeof the Initiating Events cornerstone and affects the cornerstone objective of limiting thelikelihood of those events that upset plant stability and challenge critical safety functionsduring power operations. Specifically, inadequate design control of the MBFP speedcontroller settings contributed to a reactor trip. Using IMC 0609.04, "Phase 1 - InitialScreening and Characterization of Findings," the finding was determined to have verylow safety significance (Green) because the finding did not contribute to the likelihoodthat mitigation equipment or functions would not be available.The inspectors determined there was no cross-cutting issue associated with the findingbecause the performance deficiency did not reflect Entergy's current performance.Specifically, the performance deficiency occuned more than three years ago and wasoutside the current assessment period. (Section 4OA3)
A Green self-revealing finding was identified because Entergy's procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump (MBFP) Discharge Pressure Speed Control," did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations.
 
Specifically, between May 5, 2006 and September 3, 2010, procedure 2-lC-PC-N-P-408A did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations, resulting in a slow MBFP response, which contributed to a reactor trip from 41o/o power. Entergy personneltook immediate corrective actions to change the MBFP speed controller settings.


===Cornerstone: Mitigating Systemso ===
This issue was entered into Entergy's corrective action program (CAP) as condition report (CR)-lP2-2010-05484.
 
This finding is more than minor because it is associated with the design control attribute of the Initiating Events cornerstone and affects the cornerstone objective of limiting the likelihood of those events that upset plant stability and challenge critical safety functions during power operations.
 
Specifically, inadequate design control of the MBFP speed controller settings contributed to a reactor trip. Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding did not contribute to the likelihood that mitigation equipment or functions would not be available.
 
The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect Entergy's current performance.
 
Specifically, the performance deficiency occuned more than three years ago and was outside the current assessment period. (Section 4OA3)
 
===Cornerstone: Mitigating===
 
Systems o
: '''Green.'''
: '''Green.'''
The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion X,"lnspection," because Enter,gy personnel did not ensure that quality control verificationinspections were consistently included and correctly specified in quality-affectingprocedures and work instructions for construction-like work activities as required by thequality assurance program (OAP). Entergy personnel performed extensive reviews andEnclosure 4initiated prompt fleet-wide corrective actions to ensure proper work order evaluation andproper inclusion of quality control verification inspections. This issue was entered intoEntergy's corrective action program (CAP) as CR-HQN-2009-01184 and CR-HQN-2010-001 3.This finding is more than minor because it is a programmatic deficiency that if leftuncorrected, could lead to a more significant safety concern in that the failure to checkquality attributes could involve an actual impact to plant equipment. This finding isassociated with the design control attribute of the Mitigating Systems cornerstonebecause missed quality control inspections during plant modifications could impact theavailability, reliability, and capability of systems needed to respond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," thefinding was determined to have very low safety significance (Green) because the findingis a qualification deficiency confirmed not to result in a loss of operability or functionality.Specifically, inspectors verified by sampling that work documents provided objectivequality evidence that work activities that had missed quality control verifications wereproperly performed.The finding has a cross-cutting aspect in the area of human performance associatedwith the decision-making attribute because Entergy personnel did not have an effectivesystematic process for obtaining interdisciplinary reviews of proposed work instructionsto determine whether Quality Controlverification inspections were appropriate. [H.1(a)per IMC 03101 (Section 4OA2)Green. The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion ll,"Quality Assurance Program (QAP)," because Entergy personnel did not implement thequalification and experience requirements of the QAP to ensure that an individualassigned to the position of quality assurance manager (OAM) met the qualification andexperience requirements of ANSI/ANS 3.1-1978. Specifically, the individual assigned asthe responsible person for the Entergy's overall implementation of the QAP did not haveat least one year of nuclear plant experience in the overall implementation of the QAPwithin the quality assurance organization prior to assuming those responsibilities. Thisissue was entered into Entergy's CAP as CR-HQN-2010-00386.This finding is more than minor because if left uncorrected, it could lead to a moresignificant safety concern. Specifically, the failure to have a fully qualified individualproviding overall oversight to the QAP had the potential to affect all cornerstones.However, this finding will be tracked under the Mitigating Systems cornerstone as thearea most likely to be impacted. The finding was not suitable for quantitativeassessment using existing Significance Determination Process guidance. Using IMC0609, Appendix M, "significance Determination Process Using Qualitative Criteria," NRCmanagement determined the finding to be of very low safety significance (Green)because other quality assurance program functions remained unaffected by thisperformance deficiency, so defense-in-depth continued to exist.The inspectors determined there was no cross-cutting aspect associated with this findingbecause the performance deficiency did not reflect Entergy's current performance.Specifically, the performance deficiency occurred more than three years ago and wasoutside the current assessment period. (Section 4C.A2)
The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion X,"lnspection," because Enter,gy personnel did not ensure that quality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for construction-like work activities as required by the quality assurance program (OAP). Entergy personnel performed extensive reviews and initiated prompt fleet-wide corrective actions to ensure proper work order evaluation and proper inclusion of quality control verification inspections.
 
This issue was entered into Entergy's corrective action program (CAP) as CR-HQN-2009-01184 and CR-HQN-2010-001 3.This finding is more than minor because it is a programmatic deficiency that if left uncorrected, could lead to a more significant safety concern in that the failure to check quality attributes could involve an actual impact to plant equipment.
 
This finding is associated with the design control attribute of the Mitigating Systems cornerstone because missed quality control inspections during plant modifications could impact the availability, reliability, and capability of systems needed to respond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding is a qualification deficiency confirmed not to result in a loss of operability or functionality.
 
Specifically, inspectors verified by sampling that work documents provided objective quality evidence that work activities that had missed quality control verifications were properly performed.
 
The finding has a cross-cutting aspect in the area of human performance associated with the decision-making attribute because Entergy personnel did not have an effective systematic process for obtaining interdisciplinary reviews of proposed work instructions to determine whether Quality Controlverification inspections were appropriate.
 
[H.1(a)per IMC 03101 (Section 4OA2)Green. The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion ll,"Quality Assurance Program (QAP)," because Entergy personnel did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of quality assurance manager (OAM) met the qualification and experience requirements of ANSI/ANS 3.1-1978.
 
Specifically, the individual assigned as the responsible person for the Entergy's overall implementation of the QAP did not have at least one year of nuclear plant experience in the overall implementation of the QAP within the quality assurance organization prior to assuming those responsibilities.
 
This issue was entered into Entergy's CAP as CR-HQN-2010-00386.
 
This finding is more than minor because if left uncorrected, it could lead to a more significant safety concern. Specifically, the failure to have a fully qualified individual providing overall oversight to the QAP had the potential to affect all cornerstones.
 
However, this finding will be tracked under the Mitigating Systems cornerstone as the area most likely to be impacted.
 
The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.
 
Using IMC 0609, Appendix M, "significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green)because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist.The inspectors determined there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy's current performance.
 
Specifically, the performance deficiency occurred more than three years ago and was outside the current assessment period. (Section 4C.A2)


5.
5.
: '''Green.'''
: '''Green.'''
A Green self-revealing NCV of Technical Specification (TS) 5.1, "Responsibility,"was identified because on February 9, 2010, the control room supervisor (CRS)assigned as having the control room command function, left the control room withoutdesignating another senior reactor operator (SRO) qualified individual to assume thecontrol room command function. The CRS promptly returned to the control room shortlyafter the issue was identified. This issue was entered into Entergy's CAP as CR-lP2-201 0-00708.The finding is more than minor because it could be reasonably viewed as a precursor toa significant event. Specifically, the absence of SRO oversight during licensed controlroom activities increases the likelihood of human performance errors contributing to aninitiating event and reduces the effectiveness of event mitigation. The finding isassociated with the human performance attribute of the Mitigating Systems cornerstoneand affects the cornerstone objective of ensuring the availability, reliability and capabilityof systems that respond to initiating events to prevent undesirable consequences. Thefinding was not suitable for quantitative assessment using existing SignificanceDetermination Process guidance. Using IMC 0609, Appendix M, "SignificanceDetermination Process Using Qualitative Criteria," NRC management determined thefinding to be of very low safety significance (Green) because of the short period the CRSwas absent from the control room, and because no initiating events occurred during thattime.The finding has a cross-cutting aspect in the area of human performance associatedwith the work practices attribute because of the ineffective use of shift turnover practices,in that the CRS did not self check or communicate his decision to leave the control roomto the rest of the control room staff. [H.4(a) per IMC 0310] (Section 4OA5)Gornerstone: Emergency Preparedness.
A Green self-revealing NCV of Technical Specification (TS) 5.1, "Responsibility," was identified because on February 9, 2010, the control room supervisor (CRS)assigned as having the control room command function, left the control room without designating another senior reactor operator (SRO) qualified individual to assume the control room command function.
 
The CRS promptly returned to the control room shortly after the issue was identified.
 
This issue was entered into Entergy's CAP as CR-lP2-201 0-00708.The finding is more than minor because it could be reasonably viewed as a precursor to a significant event. Specifically, the absence of SRO oversight during licensed control room activities increases the likelihood of human performance errors contributing to an initiating event and reduces the effectiveness of event mitigation.
 
The finding is associated with the human performance attribute of the Mitigating Systems cornerstone and affects the cornerstone objective of ensuring the availability, reliability and capability of systems that respond to initiating events to prevent undesirable consequences.
 
The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.
 
Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green) because of the short period the CRS was absent from the control room, and because no initiating events occurred during that time.The finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute because of the ineffective use of shift turnover practices, in that the CRS did not self check or communicate his decision to leave the control room to the rest of the control room staff. [H.4(a) per IMC 0310] (Section 4OA5)Gornerstone:
Emergency Preparedness.
: '''Green.'''
: '''Green.'''
The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions ofLicenses," paragraph (q), because Entergy staff did not implement adequatecompensatory measures when the R-27 plant vent process radiation monitor, which isused for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor wasout of service for repair following preventive maintenance with inadequate compensatorymeasures regarding the impact on EAL classification capability. Entergy personnelimplemented shortterm corrective actions by providing adequate compensatoryinstructions for the operating crews. The issue was entered into Entergy's CAP as CR-lP-2010-06721 which includes longer-term corrective actions regarding emergencypreparedness procedure changes.This finding is more than minor because it affected the Emergency ResponseOrganization attribute of the Emergency Preparedness (EP) cornerstone to ensure thatthe Entergy personnel are capable of implementing adequate measures to protect thepublic health and safety in the event of a radiological emergency. Specifically, Entergypersonnel did not provide adequate compensatory measures for when the R-27 plantvent monitors were taken out of service. In accordance with IMC 0609, Appendix B,"Emergency Preparedness Significance Determination Process," the inspectorsdetermined the finding to be of very low safety significance (Green). Using IMC 0609,Appendix B, Section 4.9 and Sheet 1, "Failure to Comply," the inspectors determinedthat the failure to comply with an aspect of the Emergency Plan related to eventEnclosure 6classification (10 CFR 50.47(bX4)) was a risk-significant planning standard (RSPS)problem; but it was not a RSPS functional failure of the Indian Point Energy Center(IPEC) event classification process.This finding has a cross-cutting aspect in the area of problem identification andresolution associated with the corrective action program attribute of taking appropriatecorrective actions to address safety issues in a timely manner. Specifically, Entergy staffdid not take appropriate emergency planning compensatory corrective actions when theR-27 plant vent radiation monitor was taken out of service, tP.1(d) per IMC 03101(Section 1R19)Green. A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses,"paragraph (q), was identified because Entergy staff did not adequately implement therequirements of the IPEC Emergency Plan. On the evening of November 7, 2010, theUnit 2 operators declared an Alert emergency at 1849 hours. The technical supportcenter (TSC) was staffed and declared operational at 2008 hours, and the operationssupport center (OSC) was staffed and declared operational at 2015 hours. Both of theseactivation times exceeded the 60-minute staffing requirement in the IPEC EmergencyPlan. This issue was entered into Entergy's CAP as CR-lP2-2010-6813, CR-lP2-2010-6831, and CR-IP2-2010-6871.This finding is more than minor because it affected the Emergency ResponseOrganization (ERO) attribute of the EP cornerstone to ensure that Entergy personnel arecapable of implementing adequate measures to protect the public health and safety inthe event of a radiological emergency. Entergy personnel did not meet the requirementsof the IPEC Emergency Plan in that the TSC and OSC were not staffed nor declaredoperational within 60 minutes of the Alert emergency declaration on November 7,2010.In accordance with IMC 0609, Appendix B, "Emergency Preparedness SignificanceDetermination Process," the inspectors determined the finding to be of very low safetysignificance (Green). Using IMC 0609, Appendix B, Section 4.2 and Sheet 2, "ActualEvent lmplementation Problem," the inspectors determined that the failure to complywith an aspect of the Emergency Plan related to ERO augmentation (10 CFR50.47(bX2)) was a non-risk-significant planning standard problem which occurred duringan Alert emergency and is therefore of very low safety significance (Green).This finding has a cross-cutting aspect in the area of human performance associatedwith the work practices attribute of defining and effectively communicating expectationsregard ing proced u ral com pliance and personnel following proced ures. Specifically,Entergy staff did not comply with ERO expectations and procedures regarding promptreporting to an assigned emergency response facility during an actual event. [H.4(b) perIMC 03101 (Section 4OA3)Green. The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions ofLicenses," paragraph (q), because the Entergy emergency plan implementing procedure(EPIP) for notification of offsite officials did not meet the requirements of the IPECEmergency Plan. This EPIP had contained a deficiency in the backup process for offsitenotification since July 2006. Entergy personnel responded by documenting thedeficiency in CR-lP2-2010-07563 and by initiating a procedure change to align thebackup process with the Emergency Plan commitments.Enclosure 7This finding is more than minor because it affected the Emergency ResponseOrganization attribute of the EP cornerstone to ensure that the Entergy personnel arecapable of implementing adequate measures to protect the public health and safety inthe event of a radiological emergency. Entergy procedures allowed for a back-upnotification process that did not comply with the requirements of the site emergencyplan: the Emergency Plan requires that the Shift Manager or his designee notify theoffsite authorities of an emergency declaration, while Form EP-4 directed the delegationof this responsibility to an offsite authority itself. In accordance with Inspection ManualChapter (lMC) 0609, Appendix B, "Emergency Preparedness Significance DeterminationProcess," the inspectors determined the finding to be of very low safety significance(Green). Using IMC 0609, Appendix B, Section 4.5 and Sheet l, "Failure to Comply,"the inspectors determined that the failure to comply with an aspect of the EmergencyPlan related to event notification (10 CFR 50.47(bX5)) was a RSPS problem. lt was nota RSPS functional failure of the IPEC event notification process, because the deficiencyin the IPEC EPIP was in the backup method for offsite notification, and despite theproceduralflaw offsite notifications were made in a timely and accurate manner onNovember 7,2010.The inspectors determined there was no cross-cutting aspect associated with this findingbecause the performance deficiency did not reflect Entergy's current performance.Specifically, the performance deficiency associated with a procedure change made inJuly 2006 occurred more than three years ago and was outside the current assessmentperiod. (Section 4OA3)
The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because Entergy staff did not implement adequate compensatory measures when the R-27 plant vent process radiation monitor, which is used for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor was out of service for repair following preventive maintenance with inadequate compensatory measures regarding the impact on EAL classification capability.
 
Entergy personnel implemented shortterm corrective actions by providing adequate compensatory instructions for the operating crews. The issue was entered into Entergy's CAP as CR-lP-2010-06721 which includes longer-term corrective actions regarding emergency preparedness procedure changes.This finding is more than minor because it affected the Emergency Response Organization attribute of the Emergency Preparedness (EP) cornerstone to ensure that the Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
Specifically, Entergy personnel did not provide adequate compensatory measures for when the R-27 plant vent monitors were taken out of service. In accordance with IMC 0609, Appendix B,"Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.9 and Sheet 1, "Failure to Comply," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to event classification (10 CFR 50.47(bX4))
was a risk-significant planning standard (RSPS)problem; but it was not a RSPS functional failure of the Indian Point Energy Center (IPEC) event classification process.This finding has a cross-cutting aspect in the area of problem identification and resolution associated with the corrective action program attribute of taking appropriate corrective actions to address safety issues in a timely manner. Specifically, Entergy staff did not take appropriate emergency planning compensatory corrective actions when the R-27 plant vent radiation monitor was taken out of service, tP.1(d) per IMC 03101 (Section 1R19)Green. A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), was identified because Entergy staff did not adequately implement the requirements of the IPEC Emergency Plan. On the evening of November 7, 2010, the Unit 2 operators declared an Alert emergency at 1849 hours. The technical support center (TSC) was staffed and declared operational at 2008 hours, and the operations support center (OSC) was staffed and declared operational at 2015 hours. Both of these activation times exceeded the 60-minute staffing requirement in the IPEC Emergency Plan. This issue was entered into Entergy's CAP as CR-lP2-2010-6813, CR-lP2-2010-6831, and CR-IP2-2010-6871.
 
This finding is more than minor because it affected the Emergency Response Organization (ERO) attribute of the EP cornerstone to ensure that Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
Entergy personnel did not meet the requirements of the IPEC Emergency Plan in that the TSC and OSC were not staffed nor declared operational within 60 minutes of the Alert emergency declaration on November 7,2010.In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.2 and Sheet 2, "Actual Event lmplementation Problem," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to ERO augmentation (10 CFR 50.47(bX2))
was a non-risk-significant planning standard problem which occurred during an Alert emergency and is therefore of very low safety significance (Green).This finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute of defining and effectively communicating expectations regard ing proced u ral com pliance and personnel following proced ures. Specifically, Entergy staff did not comply with ERO expectations and procedures regarding prompt reporting to an assigned emergency response facility during an actual event. [H.4(b) per IMC 03101 (Section 4OA3)Green. The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because the Entergy emergency plan implementing procedure (EPIP) for notification of offsite officials did not meet the requirements of the IPEC Emergency Plan. This EPIP had contained a deficiency in the backup process for offsite notification since July 2006. Entergy personnel responded by documenting the deficiency in CR-lP2-2010-07563 and by initiating a procedure change to align the backup process with the Emergency Plan commitments.
 
7 This finding is more than minor because it affected the Emergency Response Organization attribute of the EP cornerstone to ensure that the Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
Entergy procedures allowed for a back-up notification process that did not comply with the requirements of the site emergency plan: the Emergency Plan requires that the Shift Manager or his designee notify the offsite authorities of an emergency declaration, while Form EP-4 directed the delegation of this responsibility to an offsite authority itself. In accordance with Inspection Manual Chapter (lMC) 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.5 and Sheet l, "Failure to Comply," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to event notification (10 CFR 50.47(bX5))
was a RSPS problem. lt was not a RSPS functional failure of the IPEC event notification process, because the deficiency in the IPEC EPIP was in the backup method for offsite notification, and despite the proceduralflaw offsite notifications were made in a timely and accurate manner on November 7,2010.The inspectors determined there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy's current performance.
 
Specifically, the performance deficiency associated with a procedure change made in July 2006 occurred more than three years ago and was outside the current assessment period. (Section 4OA3)
 
===Cornerstone: Occupational===


===Cornerstone: Occupational Radiation Safety. ===
Radiation Safety.
: '''Green.'''
: '''Green.'''
A Green self-revealing finding was identified because Entergy personnel did notadequately plan and control work activities related to a regenerative heat exchangerpermanent shielding modification in accordance with radiation work permit (RWP)20102537 , "2R19 Permanent Regen Hx Shielding." Specifically, Entergy personnel didnot perform walkdowns to support modification package planning and provided limitedfield supervision which resulted in significant unplanned collective exposure (17189person-rem compared to a revised work activity estimate of 8.000 person-rem). Thisissue was entered into Entergy's CAP as CR-IP2-2010-02817.The finding is more than minor because it is associated with the program and processattribute of the Occupational Radiation Safety cornerstone and affected the cornerstoneobjective of ensuring the adequate protection of the worker health and safety fromexposure to radiation from radioactive material during routine reactor operations.Additionally, this finding is similar to the more than minor example 6.j provided in IMC0612, "Power Reactor Inspection Reports," Appendix E, "Examples of Minor lssues,"because it involves an actual collective exposure greater than 5 person-rem andexceeded the planned, intended dose by more than 50%. Using IMC 0609, Appendix C,"Occupational Radiation Safety Significance Determination Process," the finding wasdetermined to have very low safety significance (Green) because the finding involved anas low as reasonably achievable (ALARA) planning issue and the 3-year rolling averagecollective dose history was less than 135 person-rem (52.261 person-rem averageannual exposure for 2Q07-2Q09).The finding has a cross-cutting aspect in the area of human performance associatedwith the work control attribute because Entergy's planned work activities did notEnclosure 8adequately incorporate the job site interferences and their resolution in accordance withradiological safety. [H.3(a) per IMC 0310] (Section 2RS2)Green. A Green self-revealing finding was identified because Entergy personneldid notadequately plan and control work activities related to reactor cavity liner repair inaccordance with RWP 20102530, "2R19 Cavity Liner Repair." Specifically, outageschedule delay and inadequate work coordination resulted in the use of back-up workersto perform the reactor cavity sealant removalwork, and also resulted in reactor headshielding removal and cancellation of additional shielding that was specified in theALARA plan, which resulted in significant unplanned collective exposure (7.058 person-rem compared to a revised work activity estimate of 3.635 person-rem). This issue wasentered into Entergy's CAP as CR-lP2-2010-02817.This finding is more than minor because it is associated with the program and processattribute of the Occupational Radiation Safety cornerstone and affected the cornerstoneobjective of ensuring the adequate protection of the worker health and safety fromexposure to radiation from radioactive material during routine reactor operations. lt isalso similar to the more than minor example 6.j provided in IMC 0612, "Power ReactorInspection Reports," Appendix E, "Examples of Minor lssues," because it involves anactual collective exposure greater than 5 person-rem and exceeded the planned,intended dose by more than 50%. Using IMC 0609, Appendix C, "OccupationalRadiation Safety Significance Determination Process," the finding was determined tohave very low safety significance (Green) because the finding involved an as low asreasonably achievable (ALARA) planning issue and the 3-year rolling average collectivedose history was less than 135 person-rem (52.261 person-rem average annualexposure for 2007 -2009).The finding has a cross-cutting aspect in the area of human performance associatedwith the work coordination attribute because Entergy personnel did not coordinate andimplement work activities as planned, which resulted in significant dose overrun. [H.3(b)per IMC 03101 (Section 2RS2)
A Green self-revealing finding was identified because Entergy personnel did not adequately plan and control work activities related to a regenerative heat exchanger permanent shielding modification in accordance with radiation work permit (RWP)20102537 , "2R19 Permanent Regen Hx Shielding." Specifically, Entergy personnel did not perform walkdowns to support modification package planning and provided limited field supervision which resulted in significant unplanned collective exposure (17189 person-rem compared to a revised work activity estimate of 8.000 person-rem).
 
This issue was entered into Entergy's CAP as CR-IP2-2010-02817.
 
The finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.
 
Additionally, this finding is similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E, "Examples of Minor lssues," because it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%. Using IMC 0609, Appendix C,"Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an as low as reasonably achievable (ALARA) planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2Q07-2Q09).
 
The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy's planned work activities did not adequately incorporate the job site interferences and their resolution in accordance with radiological safety. [H.3(a) per IMC 0310] (Section 2RS2)Green. A Green self-revealing finding was identified because Entergy personneldid not adequately plan and control work activities related to reactor cavity liner repair in accordance with RWP 20102530, "2R19 Cavity Liner Repair." Specifically, outage schedule delay and inadequate work coordination resulted in the use of back-up workers to perform the reactor cavity sealant removalwork, and also resulted in reactor head shielding removal and cancellation of additional shielding that was specified in the ALARA plan, which resulted in significant unplanned collective exposure (7.058 person-rem compared to a revised work activity estimate of 3.635 person-rem).
 
This issue was entered into Entergy's CAP as CR-lP2-2010-02817.
 
This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.
 
lt is also similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E, "Examples of Minor lssues," because it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%. Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an as low as reasonably achievable (ALARA) planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007 -2009).The finding has a cross-cutting aspect in the area of human performance associated with the work coordination attribute because Entergy personnel did not coordinate and implement work activities as planned, which resulted in significant dose overrun. [H.3(b)per IMC 03101 (Section 2RS2)


===Other Findings===
===Other Findings===
Violations of very low safety significance, which were identified by Entergy personnel,have been reviewed by the inspectors. Corrective actions taken or planned have beenentered into Entergy's CAP. The violations and corrective actions are listed in Section4OA7 of this report.Enclosure 9
Violations of very low safety significance, which were identified by Entergy personnel, have been reviewed by the inspectors.
 
Corrective actions taken or planned have been entered into Entergy's CAP. The violations and corrective actions are listed in Section 4OA7 of this report.Enclosure 9


=REPORT DETAILS=
=REPORT DETAILS=
Summarv of Plant StatusIndian Point Unit 2began the inspection period operating at full reactor power (100%). The Unit2 reactor automatically tripped on November 7,2010, due to a fault on the 21 main transformer'B' phase bushing which resulted in an Alert emergency declaration. Unit 2 remained shutdownto replace the 21 main transformer, and returned to full power on November 25,2010. Unit 2remained at or near full power during the remainder of the inspection period.1. REACTORSAFETYCornerstones: Initiating Events, Mitigating Systems, and Barrier Integrity1R01 Adverse Weather Protection (71111.01 - 1 sample)lmpending Adverse Weathera. Inspection ScopeBecause severe weather was forecast in the vicinity of the facility for December 1,2Q1Q,the inspectors reviewed Entergy staff's overall preparations/protection for the expectedweather conditions. The inspectors walked down systems required for normal operationand shutdown conditions because their safety related functions could be affected, orrequired, as a result of flooding. The inspectors evaluated the plant staff's preparationsin accordance with site procedures to determine if actions were adequate. During theinspection, the inspectors focused on plant specific design features and stationprocedures used to respond to adverse weather conditions. The inspectors also touredthe site to identify loose debris that could become projectiles during a tornado. Theinspectors evaluated operator staffing and accessibility of controls and indications forthose systems required to controlthe plant. Additionally, the inspectors reviewed theUpdated Final Safety Analysis Report (UFSAR) and performance requirements for thesystems selected for inspection, and reviewed whether operator actions wereappropriate as specified by plant specific procedures. The inspectors also reviewed asample of CAP items to verify whether Entergy personnel identified adverse weatherimpact issues at an appropriate threshold and dispositioned them through the CAP inaccordance with station corrective action procedures.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one sample as defined in NRC Inspection Procedure71111.01.FindinqsNo findings were identified.Enclosure 101R04 Equipment Aliqnment (71111.04Q - 3 samples)Partial Svstem Walkdownsa. Inspection ScopeThe inspectors performed partial system walkdowns of the following risk significantsystems:. October 8, 2Q10, Appendix R diesel generator (DG) after jacket water leak repair;. October 25,2010,22 emergency diesel generator (EDG) after a maintenanceoutage; and. November 3, 2010,22 auxiliary component cooling water train after surveillancetesting.The inspectors selected these systems based on their risk significance relative to thereactor safety cornerstones at the time they were inspected. The inspectors focused onthose conditions that could affect the function of the system, and, therefore, potentiallyincrease risk. The inspectors reviewed applicable operating procedures, systemdiagrams, UFSAR, technical specification requirements, technical specifications (TSs),work orders (WOs), CRs and the impact of ongoing work activities on redundant trains ofequipment in order to identify conditions that could have impacted system performanceof their intended safety functions. The inspectors also inspected accessible portions ofthe systems to verify system components and support equipment were aligned correctlyand operable. The inspectors examined the material condition of the components andobserved operating parameters of equipment to verify that there were no deficiencies.The inspectors also reviewed whether Entergy staff had properly identified and resolvedequipment alignment problems that could cause initiating events or impact the capabilityof mitigating systems or barriers and entered them into the CAP with the appropriatesign ificance cha racterization.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of three partial system walkdown samples as defined inNRC lnspection Procedure 7 1111
Summarv of Plant Status Indian Point Unit 2began the inspection period operating at full reactor power (100%). The Unit 2 reactor automatically tripped on November 7,2010, due to a fault on the 21 main transformer
'B' phase bushing which resulted in an Alert emergency declaration.
 
Unit 2 remained shutdown to replace the 21 main transformer, and returned to full power on November 25,2010. Unit 2 remained at or near full power during the remainder of the inspection period.1. REACTORSAFETY Cornerstones:
Initiating Events, Mitigating Systems, and Barrier Integrity 1R01 Adverse Weather Protection (71111.01 - 1 sample)lmpending Adverse Weather
 
====a. Inspection Scope====
Because severe weather was forecast in the vicinity of the facility for December 1,2Q1Q, the inspectors reviewed Entergy staff's overall preparations/protection for the expected weather conditions.
 
The inspectors walked down systems required for normal operation and shutdown conditions because their safety related functions could be affected, or required, as a result of flooding.
 
The inspectors evaluated the plant staff's preparations in accordance with site procedures to determine if actions were adequate.
 
During the inspection, the inspectors focused on plant specific design features and station procedures used to respond to adverse weather conditions.
 
The inspectors also toured the site to identify loose debris that could become projectiles during a tornado. The inspectors evaluated operator staffing and accessibility of controls and indications for those systems required to controlthe plant. Additionally, the inspectors reviewed the Updated Final Safety Analysis Report (UFSAR) and performance requirements for the systems selected for inspection, and reviewed whether operator actions were appropriate as specified by plant specific procedures.
 
The inspectors also reviewed a sample of CAP items to verify whether Entergy personnel identified adverse weather impact issues at an appropriate threshold and dispositioned them through the CAP in accordance with station corrective action procedures.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one sample as defined in NRC Inspection Procedure 71111.01.Findinqs No findings were identified.
 
10 1R04 Equipment Aliqnment (71111.04Q - 3 samples)Partial Svstem Walkdowns
 
====a. Inspection Scope====
The inspectors performed partial system walkdowns of the following risk significant systems:. October 8, 2Q10, Appendix R diesel generator (DG) after jacket water leak repair;. October 25,2010,22 emergency diesel generator (EDG) after a maintenance outage; and. November 3, 2010,22 auxiliary component cooling water train after surveillance testing.The inspectors selected these systems based on their risk significance relative to the reactor safety cornerstones at the time they were inspected.
 
The inspectors focused on those conditions that could affect the function of the system, and, therefore, potentially increase risk. The inspectors reviewed applicable operating procedures, system diagrams, UFSAR, technical specification requirements, technical specifications (TSs), work orders (WOs), CRs and the impact of ongoing work activities on redundant trains of equipment in order to identify conditions that could have impacted system performance of their intended safety functions.
 
The inspectors also inspected accessible portions of the systems to verify system components and support equipment were aligned correctly and operable.
 
The inspectors examined the material condition of the components and observed operating parameters of equipment to verify that there were no deficiencies.
 
The inspectors also reviewed whether Entergy staff had properly identified and resolved equipment alignment problems that could cause initiating events or impact the capability of mitigating systems or barriers and entered them into the CAP with the appropriate sign ificance cha racterization.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of three partial system walkdown samples as defined in NRC lnspection Procedure 7 1111
 
===.04. b. Findinqs No findings were identified.===


===.04. b. FindinqsNo findings were identified.
{{a|1R05}}
{{a|1R05}}
==1R05 Fire Protection (71111.05Q - 5 samples)Resident Inspector Quarterlv Walkdownsa. lnspection ScopeThe inspectors conducted fire protection walkdowns that were focused on availability,accessibility, and the condition of firefighting equipment in the following risk significantplant areas:Enclosure==
==1R05 Fire Protection==
===
 
(71111.05Q - 5 samples)Resident Inspector Quarterlv Walkdowns a. lnspection Scope The inspectors conducted fire protection walkdowns that were focused on availability, accessibility, and the condition of firefighting equipment in the following risk significant plant areas: Enclosure b.11 r Pre-Fire Plan (PFP)-216; o PFP-2524;o PFP-260;. PFP-261; and o PFP-262.The inspectors reviewed areas to assess if Entergy personnel implemented a fire protection program that adequately controlled combustibles and ignition sources within the plant; effectively maintained fire detection and suppression capability; maintained passive fire protection features in proper material condition; and implemented adequate compensatory measures for out of service, degraded or inoperable fire protection equipment, systems, or features, in accordance with the station's fire plan. The inspectors selected fire areas based on their overall contribution to internal fire risk and their potentialto affect equipment that could initiate or mitigate a plant transient.
 
Using the documents listed in the attachment, the inspectors reviewed whether fire hoses and extinguishers were in their designated locations and available for immediate use; that fire detectors and sprinklers were unobstructed; that transient material loading was within the analyzed limits; and that fire doors, dampers, and penetration seals appeared to be in satisfactory condition.
 
The inspectors also reviewed whether issues identified during the inspection were entered into the licensee's CAP.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of five quarterly fire protection inspection samples as defined in NRC lnspection Procedure 71111.05.Findinqs No findings were identified.
 
Flood Protection Measures (71111.06 - 1 sample)1R06.1 Internal Floodinq Review
 
====a. Inspection Scope====
The inspectors reviewed the UFSAR, the site flooding analysis, and plant procedures to assess susceptibilities involving internal flooding; reviewed the CAP to determine if the licensee identified and corrected flooding problems; and verified whether operator actions for coping with flooding are adequate.
 
The inspectors also focused on the 480 volt switchgear room to verify the adequacy of equipment seals located below the flood line, floor and wall penetration seals, watertight door seals, common drain lines and sumps, sump pumps, level alarms, and control circuits, and temporcry ot removable flood barriers.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one internal flood protection measures inspection sample as defined in NRC Inspection Procedure 71111.06.Enclosure b.12 Findinqs No findings were identified.
 
Cables Located in Underqround Manholes Inspection Inspection Scope The inspectors performed an inspection of underground Manhole 21, which contains safety related electrical cabling to the service water pumps (SWPs). The inspectors reviewed the UFSAR and related design basis documents to identify the requirements for the manhole design. The inspectors assessed the material condition of the support trays and cable insulation to verify there was no evidence of conditions that could challenge operability of the safety related pumps. The inspectors reviewed whether adverse conditions discovered during the manhole inspection, if applicable, were entered into Entergy's CAP.Specific documents reviewed during this inspection are listed in the attachment.
 
This inspection completed the inspection requirement for two manhole inspections in accordance with NRC inspection procedure 71111.06.


b.11r Pre-Fire Plan (PFP)-216;o PFP-2524;o PFP-260;. PFP-261; ando PFP-262.The inspectors reviewed areas to assess if Entergy personnel implemented a fireprotection program that adequately controlled combustibles and ignition sources withinthe plant; effectively maintained fire detection and suppression capability; maintainedpassive fire protection features in proper material condition; and implemented adequatecompensatory measures for out of service, degraded or inoperable fire protectionequipment, systems, or features, in accordance with the station's fire plan. Theinspectors selected fire areas based on their overall contribution to internal fire risk andtheir potentialto affect equipment that could initiate or mitigate a plant transient. Usingthe documents listed in the attachment, the inspectors reviewed whether fire hoses andextinguishers were in their designated locations and available for immediate use; thatfire detectors and sprinklers were unobstructed; that transient material loading waswithin the analyzed limits; and that fire doors, dampers, and penetration seals appearedto be in satisfactory condition. The inspectors also reviewed whether issues identifiedduring the inspection were entered into the licensee's CAP.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of five quarterly fire protection inspection samples asdefined in NRC lnspection Procedure 71111.05.FindinqsNo findings were identified.Flood Protection Measures (71111.06 - 1 sample)1R06.1 Internal Floodinq Reviewa. Inspection ScopeThe inspectors reviewed the UFSAR, the site flooding analysis, and plant procedures toassess susceptibilities involving internal flooding; reviewed the CAP to determine if thelicensee identified and corrected flooding problems; and verified whether operatoractions for coping with flooding are adequate. The inspectors also focused on the 480volt switchgear room to verify the adequacy of equipment seals located below the floodline, floor and wall penetration seals, watertight door seals, common drain lines andsumps, sump pumps, level alarms, and control circuits, and temporcry ot removableflood barriers.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one internal flood protection measures inspectionsample as defined in NRC Inspection Procedure 71111.06.Enclosure b.12FindinqsNo findings were identified.Cables Located in Underqround Manholes InspectionInspection ScopeThe inspectors performed an inspection of underground Manhole 21, which containssafety related electrical cabling to the service water pumps (SWPs). The inspectorsreviewed the UFSAR and related design basis documents to identify the requirementsfor the manhole design. The inspectors assessed the material condition of the supporttrays and cable insulation to verify there was no evidence of conditions that couldchallenge operability of the safety related pumps. The inspectors reviewed whetheradverse conditions discovered during the manhole inspection, if applicable, wereentered into Entergy's CAP.Specific documents reviewed during this inspection are listed in the attachment. Thisinspection completed the inspection requirement for two manhole inspections inaccordance with NRC inspection procedure 71111.06. The first inspection of a manholewas documented previously in NRC lR 0500024712010003.FindinqsNo findings were identified.
The first inspection of a manhole was documented previously in NRC lR 0500024712010003.
 
Findinqs No findings were identified.
{{a|1R07}}
{{a|1R07}}
==1R07 Heat Sink Performance (71111.07A - 1 sample)a. Inspection ScopeThe inspectors reviewed the 22EDGjacket water heat exchanger to determine itsreadiness and availability to perform its safety functions. The inspectors reviewed thedesign basis for the component and Entergy's commitments to NRC Generic Letter89-13. The inspectors reviewed the results of previous inspections of the 22 EDG jacketwater and similar heat exchangers. The inspectors discussed the results of the mostrecent inspection performed on October 12,2010 with engineering, and reviewedpictures of the as-found and as-left conditions. The inspectors reviewed whetherappropriate corrective actions were initiated for deficiencies identified by Entergypersonnel. The inspectors also reviewed whether the number of tubes plugged withinthe heat exchanger did not exceed the maximum amount allowed by design.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one heat sink performance inspection sample asdefined in NRC Inspection Procedure 71111.07A.b. FindinqsNo findings were identified..2a.Enclosure==
==1R07 Heat Sink Performance==
 
(71111.07A - 1 sample)a. Inspection Scope The inspectors reviewed the 22EDGjacket water heat exchanger to determine its readiness and availability to perform its safety functions.
 
The inspectors reviewed the design basis for the component and Entergy's commitments to NRC Generic Letter 89-13. The inspectors reviewed the results of previous inspections of the 22 EDG jacket water and similar heat exchangers.
 
The inspectors discussed the results of the most recent inspection performed on October 12,2010 with engineering, and reviewed pictures of the as-found and as-left conditions.
 
The inspectors reviewed whether appropriate corrective actions were initiated for deficiencies identified by Entergy personnel.
 
The inspectors also reviewed whether the number of tubes plugged within the heat exchanger did not exceed the maximum amount allowed by design.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one heat sink performance inspection sample as defined in NRC Inspection Procedure 71111.07A.
 
b. Findinqs No findings were identified.
 
===.2 a.Enclosure===
 
13 1R1 1 Licensed Operator Requalification Proqram.1 Quarterlv Review (71111.11Q - 1 sample)a. Inspection Scope On October 13,2010, the inspectors observed a crew of licensed operators, responding to a simulated event involving a steam generator tube leak leading to a steam generator tube rupture and the failure of select components.
 
The inspectors observed the scenario in the plant simulator to verify that operator performance was adequate, evaluators were identifying and documenting crew performance problems, and that training was being conducted in accordance with licensee procedures.
 
The inspectors evaluated the following areas regarding crew and operator performance:
o Cladty and formality of communications;. lmplementation of timely actions;o Prioritization, evaluation, and verification of annunciator alarms;. Usage and implementation of abnormal and emergency procedures; o Control board operations;. ldentification and implementation of TS actions and emergency plan actions and notifications:
and. Oversight and direction from control room supervisors.
 
The inspectors compared the crew's performance in these areas to critical task completion requirements.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one quarterly licensed operator requalification program sample as defined in NRC Inspection Procedure 71111.11.b. Findinqs No findings were identified.
 
===.2 Licensed Operator Requalification===
 
(71111.118 r 1 sample)a. Inspection Scope The following inspection activities were performed using NUREG-1021, "Operator Licensing Examination Standards for Power Reactors;" and lnspection Procedure 71111.11, "Licensed Operator Requalification Program," Appendix A, "Checklist for Evaluating Facility Testing Material," and Appendix B, "Suggested Interview Topics." The NRC region-based inspectors conducted a review of recent operating history documentation found in inspection reports, licensee event reports, CAP, and the most recent NRC plant issues matrix. The inspectors also reviewed specific events from Entergy's CAP which indicated possible training deficiencies, to review whether they had been addressed appropriately.
 
The NRC senior resident inspector was also consulted for insights regarding licensed operators' performance.
 
These reviews did not detect Enclosure 14 any operational events that were indicative of possible training deficiencies.
 
The operating tests for three weeks of the exam cycle (Teams 2A, 28, and 2C) were reviewed for quality and performance.
 
On December 9, 2010, the results of the annual operating tests for year 2010 and the written exam for 2009 were reviewed to ensure pass fail rates were consistent with the guidance of NUREG-1021, "Operator Licensing Examination Standards for Power Reactors," and IMC 0609, Appendix l, "Operator Requalification Human Performance Significance Determination Process." The review verified the following:. Crew pass rates were greater than B0% (Pass rate was 100%);. Individual pass rates on the biennial written exam (administered in 2009) were greater than 80% (Pass rate was 100%);. Individual pass rates on the job performance measures of the operating exam were greater than 80% (Pass rate was 97.35o/o);
and. More lhan 75o/o of the individuals passed all portions of the exam (94.7% of the individuals passed all portions of the examination).


131R1 1 Licensed Operator Requalification Proqram.1 Quarterlv Review (71111.11Q - 1 sample)a. Inspection ScopeOn October 13,2010, the inspectors observed a crew of licensed operators, respondingto a simulated event involving a steam generator tube leak leading to a steam generatortube rupture and the failure of select components. The inspectors observed the scenarioin the plant simulator to verify that operator performance was adequate, evaluators wereidentifying and documenting crew performance problems, and that training was beingconducted in accordance with licensee procedures. The inspectors evaluated thefollowing areas regarding crew and operator performance:o Cladty and formality of communications;. lmplementation of timely actions;o Prioritization, evaluation, and verification of annunciator alarms;. Usage and implementation of abnormal and emergency procedures;o Control board operations;. ldentification and implementation of TS actions and emergency plan actions andnotifications: and. Oversight and direction from control room supervisors.The inspectors compared the crew's performance in these areas to critical taskcompletion requirements.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one quarterly licensed operator requalification programsample as defined in NRC Inspection Procedure 71111.11.b. FindinqsNo findings were identified..2 Licensed Operator Requalification (71111.118 r 1 sample)a. Inspection ScopeThe following inspection activities were performed using NUREG-1021, "OperatorLicensing Examination Standards for Power Reactors;" and lnspection Procedure71111.11, "Licensed Operator Requalification Program," Appendix A, "Checklist forEvaluating Facility Testing Material," and Appendix B, "Suggested Interview Topics."The NRC region-based inspectors conducted a review of recent operating historydocumentation found in inspection reports, licensee event reports, CAP, and the mostrecent NRC plant issues matrix. The inspectors also reviewed specific events fromEntergy's CAP which indicated possible training deficiencies, to review whether they hadbeen addressed appropriately. The NRC senior resident inspector was also consultedfor insights regarding licensed operators' performance. These reviews did not detectEnclosure 14any operational events that were indicative of possible training deficiencies.The operating tests for three weeks of the exam cycle (Teams 2A, 28, and 2C) werereviewed for quality and performance.On December 9, 2010, the results of the annual operating tests for year 2010 and thewritten exam for 2009 were reviewed to ensure pass fail rates were consistent with theguidance of NUREG-1021, "Operator Licensing Examination Standards for PowerReactors," and IMC 0609, Appendix l, "Operator Requalification Human PerformanceSignificance Determination Process." The review verified the following:. Crew pass rates were greater than B0% (Pass rate was 100%);. Individual pass rates on the biennial written exam (administered in 2009) weregreater than 80% (Pass rate was 100%);. Individual pass rates on the job performance measures of the operating exam weregreater than 80% (Pass rate was 97.35o/o); and. More lhan 75o/o of the individuals passed all portions of the exam (94.7% of theindividuals passed all portions of the examination).NRC observations were made on the dynamic simulator exams and job performancemeasures (JPM) administered during the week of September 27,2010. Theseobservations included facility evaluations of crew and individual performance during thedynamic simulator exams and individual performance of five JPMs. Nine remediationplans for crew/individual failures were reviewed to assess the effectiveness of theremedial training. Five license activation records were reviewed to ensure that 10 CFR55.53 license conditions and applicable program requirements were met.Operators, instructors, and training/operation's management were interviewed forfeedback on their training program and the quality of training received. Simulatorperformance and fidelity were reviewed for conformance to the reference plant controlroom. A sample of records for requalification training attendance, program feedback,reporting, and medical examinations were reviewed for compliance with licenseconditions, including NRC regulations.b. FindinqsNo findings were identified.
NRC observations were made on the dynamic simulator exams and job performance measures (JPM) administered during the week of September 27,2010. These observations included facility evaluations of crew and individual performance during the dynamic simulator exams and individual performance of five JPMs. Nine remediation plans for crew/individual failures were reviewed to assess the effectiveness of the remedial training.
 
Five license activation records were reviewed to ensure that 10 CFR 55.53 license conditions and applicable program requirements were met.Operators, instructors, and training/operation's management were interviewed for feedback on their training program and the quality of training received.
 
Simulator performance and fidelity were reviewed for conformance to the reference plant control room. A sample of records for requalification training attendance, program feedback, reporting, and medical examinations were reviewed for compliance with license conditions, including NRC regulations.
 
b. Findinqs No findings were identified.
{{a|1R12}}
{{a|1R12}}
==1R12 Maintenance Effectiveness (71111.12Q - 4 samples)a. Inspection ScopeThe inspectors reviewed the following areas to assess the effectiveness of maintenanceactivities on system performance and reliability. The inspectors reviewed, whenapplicable, system health reports, CAP documents, maintenance work orders, andmaintenance rule basis documents to ensure performance problems were beingidentified and properly evaluated within the scope of the maintenance rule. For eachsample selected, the inspectors reviewed whether the structure, system, and component(SSC) was properly scoped into the maintenance rule in accordance with 10 CFR 50.65and reviewed whether the (a)(2) performance criteria established by Entergy staff wereEnclosure==
==1R12 Maintenance==
 
Effectiveness (71111.12Q - 4 samples)a. Inspection Scope The inspectors reviewed the following areas to assess the effectiveness of maintenance activities on system performance and reliability.
 
The inspectors reviewed, when applicable, system health reports, CAP documents, maintenance work orders, and maintenance rule basis documents to ensure performance problems were being identified and properly evaluated within the scope of the maintenance rule. For each sample selected, the inspectors reviewed whether the structure, system, and component (SSC) was properly scoped into the maintenance rule in accordance with 10 CFR 50.65 and reviewed whether the (a)(2) performance criteria established by Entergy staff were Enclosure 15 appropriate.
 
For SSCs classified as (a)(1), the inspectors assessed the adequacy of goals and corrective actions to return these SSCs to (a)(2). Additionally, the inspectors determined if Entergy staff was identifying and addressing common cause failures that occurred within and across maintenance rule system boundaries.. 21 reactor coolant pump high bearing temperatures;. Central control room fan trips;. Containment isolation valves pressure control valves (PCVs) 1 191 and 1 192 failures;and. Main steam bypass valve MS-55D.Specific documents reviewed during this inspection are listed in the attachment.


15appropriate. For SSCs classified as (a)(1), the inspectors assessed the adequacy ofgoals and corrective actions to return these SSCs to (a)(2). Additionally, the inspectorsdetermined if Entergy staff was identifying and addressing common cause failures thatoccurred within and across maintenance rule system boundaries.. 21 reactor coolant pump high bearing temperatures;. Central control room fan trips;. Containment isolation valves pressure control valves (PCVs) 1 191 and 1 192 failures;and. Main steam bypass valve MS-55D.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of four quarterly maintenance effectiveness samples asdefined in NRC Inspection Procedure 71111.12.b. FindinqsNo findings were identified.
These activities constitute completion of four quarterly maintenance effectiveness samples as defined in NRC Inspection Procedure 71111.12.b. Findinqs No findings were identified.
{{a|1R13}}
{{a|1R13}}
==1R13 Maintenance RiskAssessments and EmerqentWork Control (71111.13-5 samples)a. Inspection ScopeThe inspectors reviewed station evaluation and management of plant risk for themaintenance and emergent work activities affecting risk significant and safety relatedequipment listed below to verify that the appropriate risk assessments were performedprior to removing equipment for work:. October 13, 2Q10, elevated risk due to 22 EDG planned maintenance, and 21 SWPand the station auxiliary transformer tap changer out for unplanned maintenance;. October 14,2Q10, elevated risk due to 26 isophase fan and 480 volt undervoltagealarm testing, and 2l SWP and 21 primary water pump out of service for unplannedmaintenance;. November 4,2010, elevated risk due to 23 charging pump and 25 SWP out ofservice for unplanned maintenance;r November 14,2010, elevated shutdown risk during restoration of electrical feeder96952; ando December 1, 2Q10, elevated risk due to 22 auxiliary boiler feed pump out of servicefor planned testing and severe weather.The inspectors selected these activities based on potential risk significance relative tothe reactor safety cornerstones. As applicable for each activity, the inspectors verifiedthat Entergy personnel performed risk assessments as required by 10 CFR 50.65(aX4)and that the assessments were accurate and complete. When Entergy personnelperformed unplanned or emergent work, the inspectors verified that operationspersonnel promptly assessed and managed plant risk. The inspectors reviewed thescope of maintenance work and discussed the results of the assessment with thestation's probabilistic risk analyst or shift technical advisor, to verify plant conditions wereconsistent with the risk assessment. The inspectors also reviewed the TS requirementsEnclosure==
==1R13 Maintenance==
 
RiskAssessments and EmerqentWork Control (71111.13-5 samples)a. Inspection Scope The inspectors reviewed station evaluation and management of plant risk for the maintenance and emergent work activities affecting risk significant and safety related equipment listed below to verify that the appropriate risk assessments were performed prior to removing equipment for work:. October 13, 2Q10, elevated risk due to 22 EDG planned maintenance, and 21 SWP and the station auxiliary transformer tap changer out for unplanned maintenance;. October 14,2Q10, elevated risk due to 26 isophase fan and 480 volt undervoltage alarm testing, and 2l SWP and 21 primary water pump out of service for unplanned maintenance;. November 4,2010, elevated risk due to 23 charging pump and 25 SWP out of service for unplanned maintenance; r November 14,2010, elevated shutdown risk during restoration of electrical feeder 96952; and o December 1, 2Q10, elevated risk due to 22 auxiliary boiler feed pump out of service for planned testing and severe weather.The inspectors selected these activities based on potential risk significance relative to the reactor safety cornerstones.


16and inspected portions of redundant safety systems, when applicable, to verify riskanalysis assumptions were valid and applicable requirements were met.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of five maintenance risk assessments and emergent workcontrol inspection samples as defined in NRC Inspection Procedure 71111.13.b. FindinqsNo findings were identified.
As applicable for each activity, the inspectors verified that Entergy personnel performed risk assessments as required by 10 CFR 50.65(aX4)and that the assessments were accurate and complete.
 
When Entergy personnel performed unplanned or emergent work, the inspectors verified that operations personnel promptly assessed and managed plant risk. The inspectors reviewed the scope of maintenance work and discussed the results of the assessment with the station's probabilistic risk analyst or shift technical advisor, to verify plant conditions were consistent with the risk assessment.
 
The inspectors also reviewed the TS requirements 16 and inspected portions of redundant safety systems, when applicable, to verify risk analysis assumptions were valid and applicable requirements were met.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of five maintenance risk assessments and emergent work control inspection samples as defined in NRC Inspection Procedure 71111.13.b. Findinqs No findings were identified.
{{a|1R15}}
{{a|1R15}}
==1R15 Operabilitv Evaluations (71111.15 - 3 samples)a. Inspection ScopeThe inspectors reviewed the following issues:. September 4, 2010, impact on containment sump from items found insidecontainment;. September 23, 2010, scaffold impact on 25 SWP piping; and. October 12,2010, EDGs heat exchanger thermal relief valves SWN-63.The inspectors selected these potential operability issues based on the risk significanceof the associated components and systems. The inspectors evaluated the technicaladequacy of the evaluations to assess whether TS operability was properly justified andthe subject component or system remained available such that no unrecognizedincrease in risk occurred. The inspectors compared the operability and design criteria inthe appropriate sections of the TSs and UFSAR to Entergy's evaluations to determinewhether the components or systems were operable. Where compensatory measureswere required to maintain operability, the inspectors determined whether the measuresin place would function as intended and were properly controlled. The inspectorsdetermined, where appropriate, compliance with bounding limitations associated with theevaluations. Additionally, the inspectors also reviewed a sampling of corrective actiondocuments to verify that Entergy personnelwere identifying and correcting anydeficiencies associated with operability evaluations.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of three operability evaluations inspection samples asdefined in NRC Inspection Procedure 71111.15.b. FindinqsNo findings were identified.Enclosure==
==1R15 Operabilitv==
 
Evaluations (71111.15 - 3 samples)a. Inspection Scope The inspectors reviewed the following issues:. September 4, 2010, impact on containment sump from items found inside containment;. September 23, 2010, scaffold impact on 25 SWP piping; and. October 12,2010, EDGs heat exchanger thermal relief valves SWN-63.The inspectors selected these potential operability issues based on the risk significance of the associated components and systems. The inspectors evaluated the technical adequacy of the evaluations to assess whether TS operability was properly justified and the subject component or system remained available such that no unrecognized increase in risk occurred.
 
The inspectors compared the operability and design criteria in the appropriate sections of the TSs and UFSAR to Entergy's evaluations to determine whether the components or systems were operable.
 
Where compensatory measures were required to maintain operability, the inspectors determined whether the measures in place would function as intended and were properly controlled.
 
The inspectors determined, where appropriate, compliance with bounding limitations associated with the evaluations.


171R18 Plant Modifications (71111.18 - 1 sample)Tem porarv Mod ificationsa. Inspection ScopeThe inspectors reviewed the following temporary modification to verify that the safetyfunctions of affected safety systems were not degraded:On October 10,2010, Entergy staff implemented WO 247503 / 2-TOP-016 on 22EDG todetermine the number of successive starts available with the starting air receiver at 250psig, and determine the minimum air start pressure for a single diesel start.The inspectors reviewed the temporary modification and the associated safetyevaluation screening against the system design bases documentation, including theUFSAR and the TSs, to verify that the modification did not adversely affect the systemoperability/availability. The inspectors also reviewed whether the installation andrestoration were consistent with the modification documents and that configurationcontrol was adequate. Additionally, the inspectors reviewed whether the temporarymodification was identified on control room drawings, appropriate tags were placed onthe affected equipment, and Entergy personnel evaluated the combined effects onmitigating systems and the integrity of radiological barriers.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one sample for temporary plant modifications asdefined in NRC lnspection Procedure 71111.18.b. FindinqsNo findings were identified.1 R19 PostMaintenance Testinq (71111.19 - 6 samples)a. Inspection ScopeThe inspectors reviewed the following post-maintenance tests (PMTs)to verify thatprocedures and test activities were adequate to ensure system operability and functionalcapability:. October 8,2Q10, Appendix R DG after jacket water leak repair;o October 13, 2010,22 EDG after maintenance;. October 27,2010, 21 SWP after motor replacement;. October 29,2Q10, 24 SWP 480 volt breaker after maintenance;. November 2, 2010, 21 SlG level channel 'C' after repairs for failing off scale low; and. November 10, 2010, Wide range effluent radiation monitor R-27 after maintenance.The inspectors selected these activities based upon the structure, system, orcomponent's ability to affect risk. The inspectors evaluated these activities to determine(as applicable) the effect of testing on the plant had been adequately addressed; testingwas adequate for the maintenance performed; acceptance criteria were clear andEnclosure 18demonstrated operational readiness; and that test instrumentation was appropriate. Theinspectors evaluated the activities against the TSs, the UFSAR, licensee procedures,and various NRC generic communications to ensure that the test results adequatelyensured that the equipment met the licensing basis and design requirements. Inaddition, the inspectors reviewed corrective action documents associated with PMTs todetermine whether Entergy personnelwere identifying problems and entering them inthe CAP and that the problems were being corrected commensurate with theirimportance to safety.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of six PMT inspection samples as defined in NRCf nspection Procedure 71111.19.FindinosInadequate Compensatorv Measures for Out-of-Service Plant Vent Process RadiationMonitgtlntroduction. The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions ofLicenses," paragraph (q), because Entergy staff did not implement adequatecompensatory measures when the R-27 plant vent process radiation monitor, which isused for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor wasout of service for repair following preventive maintenance with inadequate compensatorymeasures.Description. On October 25,2010, Entergy personnel removed the R-27 plant ventprocess radiation monitor from service for a two year preventive maintenance (PM)activity. The R-27 monitor is used by operators in the emergency plan for identifying aradiological release and making EAL declarations and is listed in the TechnicalRequirements Manual (TRM) for post accident monitoring. Entergy operators enteredTRM action statement 3.3.G, which requires R-27 restoration to operable status withinseven days. The PM activity was delayed because a part needed for replacement wasnot readily available. On November 1 , 2010, the seven-day TRM action statement wasexceeded, for which the required actions were to initiate an alternative method ofmonitoring the appropriate parameters and prepare a corrective action program report in14 days. Entergy personnel established a compensatory measure by utilizing the R-44plant vent radiation monitor which also monitors plant vent flow.On November 2,2010, the inspectors questioned the station's use of R-44 tocompensate for the R-27, because the R-44 process radiation monitor has a lowerindicating range and would only support declaring an Unusual Event and not higher EALclassifications. The inspectors concluded Entergy personnel had not identified thislimitation of the R-44 monitor. Entergy procedure lP-EP-AD40, "Equipment lmportant toEmergency Response," provides compensatory measures when R-27 monitor isunavailable, for both the monitor's roles of radiological release identification (includingEAL thresholds) and dose assessment. For the release identification, the proceduredirected operators to perform manual sampling in accordance with the unit's TS.However, as a result of further inspector questions, Entergy staff determined thisinformation had been removed from the TS. The inspectors determined that a numberEnclosure 19of instruments used for EP functions listed in procedure IP-EP-AD4O also had the TSreferenced as an alternative measure for their use.Following the inspectors' initial questioning, EP department personnel provided theoperators contingency guidance to be implemented when the R-27 monitor is out ofservice. This guidance implemented procedures lP-EP-310, "Dose Assessment," andIP-EP-1 15, "Emergency Plan Forms," using remotely installed radiation monitors orhand-held teletectors, and mathematical conversion equations, to provide plant ventrelease information. The inspectors questioned whether Entergy personnel could verifythat Site Area Emergency or General Emergency area dose rates would allow formanual measurement of the plant vent dose rates. Entergy personnel subsequentlyaffirmed that the process was implementable under all design-basis conditions andissued appropriate direction to the operating crews in an interim guidance document onNovember 24,2010. Entergy personnel documented the need for interim guidancewhen the R-27 monitor is out of service in CR-!P2-2Q10-06718, and the need to reviseprocedure lP-EP-AD40 to update the alternative measures for instrumentation neededfor EAL actions in CR-lP2-2010-06721.The inspectors determined that not having R-27 monitor radiation readings available forevent classification, without adequate compensatory measures, was a failure to maintainthe requirements of the IPEC Emergency Plan. The inspectors determined the finalversion of the interim guidance for operations personnel was adequate. The inspectorsdetermined that the IPEC EAL scheme has redundant EALs based on the status offission product barriers, the failure of reactor fuel, and the condition of the maincontainment, that would result in equivalent classifications for postulated accident eventsabove an Unusual Event level. The inspectors determined these capabilities providedassurance that any delay in obtaining plant vent process radiation monitor readings bymanual methods when the R-27 monitor was unavailable would not have affected theoutcome of protecting the health and safety of the public or of station personnel.Analvsis. The performance deficiency associated with this finding was that Entergypersonnel did not provide adequate compensatory measures for when the R-27 plantvent monitor was removed from service. This finding is more than minor because it wasassociated with the ERO attribute of the EP Cornerstone and affected the cornerstoneobjective to ensure that the licensee is capable of implementing adequate measures toprotect the public health and safety in the event of a radiological emergency.In accordance with Inspection Manual Chapter (lMC) 0609, Appendix B, "EmergencyPreparedness Significance Determination Process," the inspectors determined thefinding was of very low safety significance (Green). Specifically, the inspectors utilizedIMC 0609, Appendix B, Section 4.4 and Sheet 1, "Failure to Comply," and determinedthat the failure to comply with an aspect of the Emergency Plan related to eventclassification (10 CFR 50.47(bX4)) was a RSPS problem; but it was not a RSPSfunctional failure of the IPEC event classification process. The inability to determine therelease rate through the main stack plant vent when the R-27 monitor was out of servicewas a failure to comply with the regulations; however, redundant EALs in the IPEC Unit2 EAL would have resulted in equivalent classifications for postulated accident eventsabove an Unusual Event level. These capabilities provided assurance that thisperformance deficiency ultimately would not have affected the outcome of protecting thehealth and safety of the public or of station personnel.Enclosure 20This finding has a cross-cutting aspect in the area of problem identification andresolution associated with the corrective action program attribute of taking appropriatecorrective actions to address safety issues in a timely manner. Specifically, Entergy staffdid not provide for appropriate emergency planning compensatory corrective actionswhen the R-27 monitor was removed from service. tP.1(d) per IMC 03101Enforcemerf.t. 10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part,that a licensee "shall follow and maintain in effect emergency plans which meet thestandards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR50.47(bX4) requires, in part, that "a standard emergency classification and action levelscheme, the bases of which include facility system and effluent parameters, is in use bythe nuclear facility licensee."Contrary to the above, from October 25,2010 to November 24,2010, Entergy personneldid not have an adequate method or equipment in place, under certain accidentconditions, for identifying and classifying an offsite release through the plant main ventwhen the R-27 monitor was out of service. As a result, this condition could haveresulted in an unnecessary delay in identifying plant vent releases that would haveresulted in the declaration of an emergency event above the Unusual Event level. Byfailing to meet the requirements of 10 CFR 50.47(bX4), Entergy was in violation of 10CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan.Entergy personnel corrected this deficiency by issuing adequate guidance to the Unit 2operating crews when the R-27 monitor was removed from service. Because this findingis of very low safety significance and was entered into Entergy's CAP as CR-IP2-2010-06721, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation isbeing treated as a NCV: NCV 00500024712010005-01, Inadequate CompensatoryMeasures for Out-of-Service Plant Vent Process Radiation Monitor.
Additionally, the inspectors also reviewed a sampling of corrective action documents to verify that Entergy personnelwere identifying and correcting any deficiencies associated with operability evaluations.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of three operability evaluations inspection samples as defined in NRC Inspection Procedure 71111.15.b. Findinqs No findings were identified.
 
17 1R18 Plant Modifications (71111.18 - 1 sample)Tem porarv Mod ifications
 
====a. Inspection Scope====
The inspectors reviewed the following temporary modification to verify that the safety functions of affected safety systems were not degraded: On October 10,2010, Entergy staff implemented WO 247503 / 2-TOP-016 on 22EDG to determine the number of successive starts available with the starting air receiver at 250 psig, and determine the minimum air start pressure for a single diesel start.The inspectors reviewed the temporary modification and the associated safety evaluation screening against the system design bases documentation, including the UFSAR and the TSs, to verify that the modification did not adversely affect the system operability/availability.
 
The inspectors also reviewed whether the installation and restoration were consistent with the modification documents and that configuration control was adequate.
 
Additionally, the inspectors reviewed whether the temporary modification was identified on control room drawings, appropriate tags were placed on the affected equipment, and Entergy personnel evaluated the combined effects on mitigating systems and the integrity of radiological barriers.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one sample for temporary plant modifications as defined in NRC lnspection Procedure 71111.18.b. Findinqs No findings were identified.
 
1 R19 PostMaintenance Testinq (71111.19 - 6 samples)a. Inspection Scope The inspectors reviewed the following post-maintenance tests (PMTs)to verify that procedures and test activities were adequate to ensure system operability and functional capability:. October 8,2Q10, Appendix R DG after jacket water leak repair;o October 13, 2010,22 EDG after maintenance;. October 27,2010, 21 SWP after motor replacement;. October 29,2Q10, 24 SWP 480 volt breaker after maintenance;. November 2, 2010, 21 SlG level channel 'C' after repairs for failing off scale low; and. November 10, 2010, Wide range effluent radiation monitor R-27 after maintenance.
 
The inspectors selected these activities based upon the structure, system, or component's ability to affect risk. The inspectors evaluated these activities to determine (as applicable)the effect of testing on the plant had been adequately addressed; testing was adequate for the maintenance performed; acceptance criteria were clear and Enclosure 18 demonstrated operational readiness; and that test instrumentation was appropriate.
 
The inspectors evaluated the activities against the TSs, the UFSAR, licensee procedures, and various NRC generic communications to ensure that the test results adequately ensured that the equipment met the licensing basis and design requirements.
 
In addition, the inspectors reviewed corrective action documents associated with PMTs to determine whether Entergy personnelwere identifying problems and entering them in the CAP and that the problems were being corrected commensurate with their importance to safety.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of six PMT inspection samples as defined in NRC f nspection Procedure 71111.19.Findinos Inadequate Compensatorv Measures for Out-of-Service Plant Vent Process Radiation Monitgt lntroduction.
 
The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because Entergy staff did not implement adequate compensatory measures when the R-27 plant vent process radiation monitor, which is used for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor was out of service for repair following preventive maintenance with inadequate compensatory measures.Description.
 
On October 25,2010, Entergy personnel removed the R-27 plant vent process radiation monitor from service for a two year preventive maintenance (PM)activity.
 
The R-27 monitor is used by operators in the emergency plan for identifying a radiological release and making EAL declarations and is listed in the Technical Requirements Manual (TRM) for post accident monitoring.
 
Entergy operators entered TRM action statement 3.3.G, which requires R-27 restoration to operable status within seven days. The PM activity was delayed because a part needed for replacement was not readily available.
 
On November 1 , 2010, the seven-day TRM action statement was exceeded, for which the required actions were to initiate an alternative method of monitoring the appropriate parameters and prepare a corrective action program report in 14 days. Entergy personnel established a compensatory measure by utilizing the R-44 plant vent radiation monitor which also monitors plant vent flow.On November 2,2010, the inspectors questioned the station's use of R-44 to compensate for the R-27, because the R-44 process radiation monitor has a lower indicating range and would only support declaring an Unusual Event and not higher EAL classifications.
 
The inspectors concluded Entergy personnel had not identified this limitation of the R-44 monitor. Entergy procedure lP-EP-AD40, "Equipment lmportant to Emergency Response," provides compensatory measures when R-27 monitor is unavailable, for both the monitor's roles of radiological release identification (including EAL thresholds)and dose assessment.
 
For the release identification, the procedure directed operators to perform manual sampling in accordance with the unit's TS.However, as a result of further inspector questions, Entergy staff determined this information had been removed from the TS. The inspectors determined that a number Enclosure 19 of instruments used for EP functions listed in procedure IP-EP-AD4O also had the TS referenced as an alternative measure for their use.Following the inspectors' initial questioning, EP department personnel provided the operators contingency guidance to be implemented when the R-27 monitor is out of service. This guidance implemented procedures lP-EP-310, "Dose Assessment," and IP-EP-1 15, "Emergency Plan Forms," using remotely installed radiation monitors or hand-held teletectors, and mathematical conversion equations, to provide plant vent release information.
 
The inspectors questioned whether Entergy personnel could verify that Site Area Emergency or General Emergency area dose rates would allow for manual measurement of the plant vent dose rates. Entergy personnel subsequently affirmed that the process was implementable under all design-basis conditions and issued appropriate direction to the operating crews in an interim guidance document on November 24,2010. Entergy personnel documented the need for interim guidance when the R-27 monitor is out of service in CR-!P2-2Q10-06718, and the need to revise procedure lP-EP-AD40 to update the alternative measures for instrumentation needed for EAL actions in CR-lP2-2010-06721.
 
The inspectors determined that not having R-27 monitor radiation readings available for event classification, without adequate compensatory measures, was a failure to maintain the requirements of the IPEC Emergency Plan. The inspectors determined the final version of the interim guidance for operations personnel was adequate.
 
The inspectors determined that the IPEC EAL scheme has redundant EALs based on the status of fission product barriers, the failure of reactor fuel, and the condition of the main containment, that would result in equivalent classifications for postulated accident events above an Unusual Event level. The inspectors determined these capabilities provided assurance that any delay in obtaining plant vent process radiation monitor readings by manual methods when the R-27 monitor was unavailable would not have affected the outcome of protecting the health and safety of the public or of station personnel.
 
Analvsis.
 
The performance deficiency associated with this finding was that Entergy personnel did not provide adequate compensatory measures for when the R-27 plant vent monitor was removed from service. This finding is more than minor because it was associated with the ERO attribute of the EP Cornerstone and affected the cornerstone objective to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
In accordance with Inspection Manual Chapter (lMC) 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding was of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.4 and Sheet 1, "Failure to Comply," and determined that the failure to comply with an aspect of the Emergency Plan related to event classification (10 CFR 50.47(bX4))
was a RSPS problem; but it was not a RSPS functional failure of the IPEC event classification process. The inability to determine the release rate through the main stack plant vent when the R-27 monitor was out of service was a failure to comply with the regulations; however, redundant EALs in the IPEC Unit 2 EAL would have resulted in equivalent classifications for postulated accident events above an Unusual Event level. These capabilities provided assurance that this performance deficiency ultimately would not have affected the outcome of protecting the health and safety of the public or of station personnel.
 
20 This finding has a cross-cutting aspect in the area of problem identification and resolution associated with the corrective action program attribute of taking appropriate corrective actions to address safety issues in a timely manner. Specifically, Entergy staff did not provide for appropriate emergency planning compensatory corrective actions when the R-27 monitor was removed from service. tP.1(d) per IMC 03101 Enforcemerf.t.
 
10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part, that a licensee "shall follow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX4)requires, in part, that "a standard emergency classification and action level scheme, the bases of which include facility system and effluent parameters, is in use by the nuclear facility licensee." Contrary to the above, from October 25,2010 to November 24,2010, Entergy personnel did not have an adequate method or equipment in place, under certain accident conditions, for identifying and classifying an offsite release through the plant main vent when the R-27 monitor was out of service. As a result, this condition could have resulted in an unnecessary delay in identifying plant vent releases that would have resulted in the declaration of an emergency event above the Unusual Event level. By failing to meet the requirements of 10 CFR 50.47(bX4), Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan.Entergy personnel corrected this deficiency by issuing adequate guidance to the Unit 2 operating crews when the R-27 monitor was removed from service. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR-IP2-2010-06721, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 00500024712010005-01, Inadequate Compensatory Measures for Out-of-Service Plant Vent Process Radiation Monitor.
{{a|1R20}}
{{a|1R20}}
==1R20 Refuelino and Outaqe Activities (71111.20 - 1 sample)a. Inspection ScopeThe inspectors reviewed the outage safety plan and contingency plans for the Unit 2unplanned maintenance outage to replace the 21 main transformer, conductedNovember 7 - 23,2010. The inspectors'review considered whether Entergy personnelappropriately considered risk, industry experience, and previous site performance indeveloping and implementing a plan that assured maintenance of defense in depth withregards to reactor safety. During the maintenance outage, the inspectors observedportions of the shutdown and cooldown processes and monitored Entergy operatorcontrols over the outage activities listed below:. Configuration management, including maintenance of defense in depth,commensurate with the outage safety plan for key safety functions and compliancewith the applicable TSs when taking equipment out of service;r Clearance activities, including confirmation that tags were properly hung andequipment appropriately configured to safely support the work or testing;. Status and configuration of electrical systems to ensure that TSs and outageplanning requirements were met, and controls over switchyard activities wereappropriate;o Monitoring of decay heat removal processes, systems, and components;Enclosure==
==1R20 Refuelino==
 
and Outaqe Activities (71111.20 - 1 sample)a. Inspection Scope The inspectors reviewed the outage safety plan and contingency plans for the Unit 2 unplanned maintenance outage to replace the 21 main transformer, conducted November 7 - 23,2010. The inspectors'review considered whether Entergy personnel appropriately considered risk, industry experience, and previous site performance in developing and implementing a plan that assured maintenance of defense in depth with regards to reactor safety. During the maintenance outage, the inspectors observed portions of the shutdown and cooldown processes and monitored Entergy operator controls over the outage activities listed below:. Configuration management, including maintenance of defense in depth, commensurate with the outage safety plan for key safety functions and compliance with the applicable TSs when taking equipment out of service;r Clearance activities, including confirmation that tags were properly hung and equipment appropriately configured to safely support the work or testing;. Status and configuration of electrical systems to ensure that TSs and outage planning requirements were met, and controls over switchyard activities were appropriate; o Monitoring of decay heat removal processes, systems, and components; 21 r Controls over activities that could affect reactivity;. Maintenance of secondary containment as required by the TS;r Startup and ascension to full power operation, tracking of startup prerequisites;. Station personnel identification and resolution of problems related to maintenance outage activities; and. Work hours for fatigue concerns.Specific documents reviewed during this inspection are listed in the attachment.


21r Controls over activities that could affect reactivity;. Maintenance of secondary containment as required by the TS;r Startup and ascension to full power operation, tracking of startup prerequisites;. Station personnel identification and resolution of problems related to maintenanceoutage activities; and. Work hours for fatigue concerns.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one other outage inspection sample as defined in NRClnspection Procedure 7 1111
These activities constitute completion of one other outage inspection sample as defined in NRC lnspection Procedure 7 1111
 
===.20. b. Findinqs No findings were identified.===


===.20. b. FindinqsNo findings were identified.
{{a|1R22}}
{{a|1R22}}
==1R22 Surveillance Testinq (71111.22 - 5 samples)a. Inspection ScopeThe inspectors observed performance of surveillance tests andior reviewed test data ofselected risk significant SSCs, to assess whether test results satisfied TSs, UFSAR,technical requirements manual (TRM), and Entergy procedure requirements. Theinspectors verified that test acceptance criteria were sufficiently clear; testsdemonstrated operational readiness and were consistent with design basisdocumentation; test instrumentation had accurate calibrations and appropriate rangeand accuracy for the application; tests were performed as written; and applicable testprerequisites were satisfied. Following the tests, the inspectors considered whether thetest results supported conclusions that equipment was capable of performing therequired safety functions. The following surveillance tests were reviewed:. September 1, 2010, 2-PT-Q017C, alternate safe shutdown supply verification to23 component cooling water pump;. September 12, 2010, 2-OSP-4.1.2, support procedure - component coolingsystem operation;r October 18,2010, 2-PT-Q028A,21 residual heat removal pump test;. October 1 8,2010, 2-PT-Q013, data sheet 43,22 safety injection (Sl) pump tie to21 Sl pump discharge valve in-service valve test; and. December 17,2010, reactor coolant system (RCS) leak rate surveillance test.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of five surveillance testing inspection samples as definedin NRC Inspection Procedure 71111.22.b. FindinqsNo findings were identified.Enclosure==
==1R22 Surveillance==
===
 
Testinq (71111.22 - 5 samples)a. Inspection Scope The inspectors observed performance of surveillance tests andior reviewed test data of selected risk significant SSCs, to assess whether test results satisfied TSs, UFSAR, technical requirements manual (TRM), and Entergy procedure requirements.
 
The inspectors verified that test acceptance criteria were sufficiently clear; tests demonstrated operational readiness and were consistent with design basis documentation; test instrumentation had accurate calibrations and appropriate range and accuracy for the application; tests were performed as written; and applicable test prerequisites were satisfied.
 
Following the tests, the inspectors considered whether the test results supported conclusions that equipment was capable of performing the required safety functions.
 
The following surveillance tests were reviewed:. September 1, 2010, 2-PT-Q017C, alternate safe shutdown supply verification to 23 component cooling water pump;. September 12, 2010, 2-OSP-4.1.2, support procedure - component cooling system operation; r October 18,2010, 2-PT-Q028A,21 residual heat removal pump test;. October 1 8,2010, 2-PT-Q013, data sheet 43,22 safety injection (Sl) pump tie to 21 Sl pump discharge valve in-service valve test; and. December 17,2010, reactor coolant system (RCS) leak rate surveillance test.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of five surveillance testing inspection samples as defined in NRC Inspection Procedure 71111.22.b. Findinqs No findings were identified.
 
22 Cornerstone:
Emergency Preparedness (EP)lEPO Drill Evaluation (71114.06 - 1 sample)a. Inspection Scope The inspectors evaluated operator performance during a simulator scenario conducted on October 13,2Q10, to identify any weaknesses and deficiencies in classification, notification, and protective action recommendation development activities.
 
The inspectors observed emergency response operations in the simulator to determine whether the event classification, notifications, and protective action recommendations were performed in accordance with procedures.
 
The inspectors also attended the station drill critique to compare inspector observations with those identified by Entergy staff in order to evaluate Entergy's critique and to verify whether the Entergy staff was properly identifying weaknesses and entering them into the CAP.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one sample as defined in NRC lnspection Procedure 71114.06.b. Findinqs No findings were identified.
 
===2. RADIATION ===
 
SAFEW Cornerstone:
Occupational/Public Radiation Safety (PS)2RS1 Radioloqical Hazard Assessment and Exposure Controls (71124.01*
1 sample)a. lnspection Scope Inspection Planning The inspectors reviewed all licensee performance indicators (Pls) for the Occupational Exposure cornerstone for follow up and reviewed the results of the most recent radiation protection program audit.Contamination and Radioactive Material Control The inspectors selected three sealed sources from the licensee's inventory records, verified that the sources were accounted for, and have been leak tested within the past six months. The inspectors verified that there have not been any source transfer transactions since the last inspection involving nationally tracked sources.Radioloqical Hazards Control and Work Coverare During tours of the facility and review of ongoing work, the inspectors evaluated ambient radiological conditions, verified that existing conditions were consistent with posted suryeys, RWPs, and worker briefings, as applicable.
 
During available job performance observations, the inspectors verified the adequacy of radiological controls, radiation Enclosure 23 protection job coverage, contamination controls, and evaluated the licensee's use of electronic pocket dosimeters in high noise areas. The inspectors verified that dosimeters of legal record were being placed on the individual's body consistent with monitoring the highest expected dose due to external radiation sources.During this inspection, there were no active work activities within airborne radioactivity areas with the potentialfor individual worker internal exposures for evaluation.
 
The inspectors examined the licensee's physical and programmatic controls for highly activated or contaminated materials (nonfuel)stored within spent fuel and other storage pools and verified that appropriate controls were in place to preclude inadvertent removal of these materials from the pools. The inspectors conducted selective inspection of posting and physical controls for high radiation areas (HRAs) and very high radiation areas (VHRAs) to verify conformance with TS and procedural requirements.
 
Risk Siqnificant Hiqh Radiation Area and Verv Hiqh Radiation Area Controls The inspectors reviewed the controls and procedures for high risk HRAs and VHRAS.The inspectors verified that any changes to licensee procedures did not substantially reduce the effectiveness and level of worker protection.
 
The inspectors discussed with a health physics supervisor the controls in place for special areas that have the potential to become VHRAs during certain plant operations to determine if these plant operations include prior communication with the HP organization to allow for timely actions to properly post, control, and monitor the radiation hazards including re-access authorization.
 
Radiation Worker Performance During job performance observations, the inspectors observed radiation worker performance with respect to radiation work permit requirements to determine if workers are aware of the radiological conditions in their workplace and if their work performance reflects the conditions of the radiation work permit requirements.
 
The inspectors reviewed several radiological problem reports since the last inspection that include the cause of the event to be attributable to human performance errors. This review included a determination of any similar observable patterns and effectiveness review of any prior corrective actions taken by the licensee to resolve any similar prior radiological problems.Radiation Protection Technician Proficiencv During job performance obseryations, the inspectors observed the performance of radiation protection technicians with respect to applicable radiation work permit requirements to determine if technicians were aware of the radiological conditions in their workplace, the RWP controls/limits in place and if their performance was consistent with their training and qualifications with respect to the radiological hazards and work activities.
 
The inspectors reviewed several radiological problem reports since the last inspection that include the cause of the event to be attributable to radiation protection technician error. This review included a determination of any similar observable patterns and effectiveness review of any prior corrective actions taken by the licensee to resolve any similar prior radiological problems.Enclosure b.a.2RS2 24 Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one sample as defined in NRC Inspection Procedure 71124.01.Findinqs No findings were identified.
 
OccupationalALARA Planninq and Controls (71124.02 - 1 sample)Inspection Scope Inspection Plannino The inspectors reviewed site procedures associated with maintaining occupational exposures ALARA, including a review of processes used to estimate and track exposures from specific work activities.
 
Radioloqical Work Planninq Based on radiation work permit outage work activity collective exposure results from the Unit 2 Spring 2010 refueling outage, the inspectors selected for review those work activities that resulted in a dose of 5 person-rem or greater. This review included the basis of the exposure estimates with reference to historical performance metrics, and exposure mitigation requirements planned for these outage tasks.With respect to the outage work activity samples, the inspectors compared the actual exposure results with the estimated exposure established in the licensee's ALAM plans for these work activities.
 
The inspectors also compared the person-hour estimates provided by maintenance planning and other groups to the radiation protection group with the work activity person-hour actual results, to evaluate the performance results.The inspectors determined the reasons (e.9., failure to adequately plan the activity, failure to provide sufficient work controls)for any inconsistencies between intended and actual work activity doses. The inspectors also determined if any identified exposure overrun causes were identified and entered into Entergy's CAP.Verification of Dose Estimates and Exposure Trackinq Svstems The Unit 2 Spring refueling outage ALARA work packages that resulted in greater than 5 person-rem were reviewed to include the assumptions and basis (including dose rate and man-hour estimates)for their collective exposure estimates.
 
Applicable procedures were reviewed to determine the methodology for estimating exposures for specific work activities and determining the intended dose outcome.The inspectors verified for the selected work activities that the licensee has established measures to track, trend, and if necessary to reduce, occupational doses for ongoing work activities and that criteria are established to prompt additional reviews and/or additionalALARA planning and controls.
 
The inspectors evaluated the licensee's method of adjusting exposure estimates when unexpected changes in scope or emergent work were encountered.
 
The inspectors determined if adjustments to Enclosure b..1 25 exposure estimates (intended dose)were based on sound radiation protection and ALARA principles or if they were only adjusted to account for failures to control the work.Source TeJn Reduction and Control Through a review of licensee records, the inspectors evaluated the historical trends and current status of significant tracked plant source terms known to contribute to elevated facility aggregate exposure and reviewed the licensee's contingency plans for expected changes in the source term as the result of changes in plant fuel performance issues or changes in plant primary chemistry.
 
Radiation Worker Performance The inspectors observed radiation worker and radiation protection technician performance during work activities being performed in radiation areas and high radiation areas. The inspectors determined if workers demonstrated the ALARA philosophy in practice and whether there were any procedure compliance issues and whether the training and skill level of the radiation workers was sufficient with respect to the radiological hazards and the work tasks involved.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one sample as defined in NRC Inspection Procedure 71124.02.Findings Inadequate Work Planninq Control Relative to_Beqenerative Heat E4ghanqer Permanen!Shieldinq Modiflgation That Resulted jn Additional Unplanned Collective Exposule lntroduction.
 
A Green self-revealing finding was identified because Entergy personnel did not adequately plan and control work activities related to a regenerative heat exchanger permanent shielding modification in accordance with RWP 20102537, "2R19 Permanent Regenerative Heat Exchanger Shielding" which resulted in significant unplanned exposure.Desplription.
 
During Refueling Outage 19, Entergy's RWP 20102537 provided the ALARA plan and dose estimate standard for the regenerative heat exchanger permanent shielding modification.
 
The regenerative heat exchanger permanent shielding modification dose exceeded the planned dose estimate in RWP 20102537.
 
Entergy personnel determined the dose estimates were exceeded due to inadequate work activity planning and control. The lack of in-field walkdowns prior to designing the modification resulted in as-found interferences, and due to limited field supervision, the resulting construction modification was performed in a posted high radiation area. ln addition, the construction workers performing the work did not have an assigned project lead to direct the in-field work, which resulted in delays in completing the modification within time estimates as assumed in the dose planning.
 
These factors resulted in additional collective exposure that Entergy could have reasonably avoided had sufficient work activity planning and additional in-field supervision occurred.The inspectors reviewed RWP 20102537 and determined the actualjob site conditions for installation of the regenerative heat exchanger permanent shielding were not Enclosure 26 adequately evaluated for interferences and when revealed, measures were not taken by Entergy personnel to prefabricate the modifications outside of a high radiation area, resulting in additional unnecessary personnel exposure.
 
The original exposure work estimate was 6.8 person-rem.
 
In order to provide allowance for higher dose rates than anticipated, the original estimate was increased to 8.0 person-rem, however the actual work activity exposure was 17
 
===.189 person-rem===
 
(115To greater than the revised exposure estimate).
 
This issue was entered into Entergy's CAP as CR-IP2-2010-02817.
 
Analvsis.
 
The performance deficiency associated with this finding was that Entergy personnel did not adequately plan and controlwork activities related to a regenerative heat exchanger permanent shielding modification in accordance with RWP 20102537.This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.
 
lt is also similar to the more than minor example 6,j provided in IMC 0612, "Power Reactor lnspection Reports," Appendix E, "Examples of Minor lssues," since it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an ALARA planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007-2009).
 
The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy's planned work activities did not adequately incorporate the job site interferences and their resolution in accordance radiological safety. [H.3(a) per IMC 0310]Enforcement.
 
This finding does not involve enforcement action because no regulatory requirement violation was identified.
 
Because this finding does not involve a violation, has very low safety significance, and was entered into Entergy's CAP as CR-lP2-2010-02817, it is identified as a finding: FIN 0500024712010005-02, Inadequate Work Planning Gontrol Retative to Regenerative Heat Exchanger Permanent Shielding Modification That Resulted in Additional Unplanned Gollective Exposure.lnadequate Work Coordination Relative to Reactor Cavitv Liner Repair That Resulted in Additional Unplanned Collg;tive Expg.sure
 
=====Introduction.=====
A Green self-revealing finding was identified because Entergy personnel did not adequately plan and controlwork activities related to reactor cavity liner repair in accordance with RWP 20102530, "2R19 Cavity Liner Repair" which resulted in significant unplanned collective exposure.Description.
 
During Refueling Outage 19, Entergy's RWP 20102530 provided the ALARA plan and dose estimate standard for the work activity.
 
The Unit 2 reactor cavity liner repair dose exceeded the planned dose estimate in RWP 20102530.
 
Entergy personnel determined the dose estimate was exceeded due to inadequate work coordination and ALARA plan implementation.
 
Schedule delays resulted in the intended.2 Enclosure 27 contractor vendor not being able to conduct the work as planned, resulting in the use of back-up workers to perform the cavity sealant removalwork, which resulted in additional person-hours to complete this work. Also due to schedule delays, the reactor head shielding was removed while the cavity liner repair work was still in progress, which resulted in higher than planned exposures.
 
In addition, due to the delayed and compressed schedule, the planned shielding for the cavity boring work was not applied as planned, which resulted in higher exposures.
 
The inspectors reviewed RWP 20102530 and determined the additional person-hours to perform the reactor cavity sealant removal, the removal of reactor head shielding, and failure to provide the planned cavity boring shielding resulted in additional collective exposure that could have been avoided had sufficient work coordination and work plan implementation been performed.
 
The original exposure work estimate was 3.09 person-rem. For purposes of this analysis, in order to provide allowance for higher dose rates than anticipated, the original estimate was increased to 3.635 person-rem.
 
When compared to the actual work activity exposure of 7.058 person-rem, the results were 94% greater than the revised exposure estimate.
 
This issue was entered into Entergy's CAP as CR-!P2-201 0-02817 .Analvsis.
 
The performance deficiency associated with this finding was that Entergy personnel did not adequately plan and controlwork activities related to the reactor cavity liner repair in accordance with RWP 20102530.
 
This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.


22Cornerstone: Emergency Preparedness (EP)lEPO Drill Evaluation (71114.06 - 1 sample)a. Inspection ScopeThe inspectors evaluated operator performance during a simulator scenario conductedon October 13,2Q10, to identify any weaknesses and deficiencies in classification,notification, and protective action recommendation development activities. Theinspectors observed emergency response operations in the simulator to determinewhether the event classification, notifications, and protective action recommendationswere performed in accordance with procedures. The inspectors also attended thestation drill critique to compare inspector observations with those identified by Entergystaff in order to evaluate Entergy's critique and to verify whether the Entergy staff wasproperly identifying weaknesses and entering them into the CAP.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one sample as defined in NRC lnspectionProcedure 71114.06.b. FindinqsNo findings were identified.2. RADIATION SAFEWCornerstone: Occupational/Public Radiation Safety (PS)2RS1 Radioloqical Hazard Assessment and Exposure Controls (71124.01* 1 sample)a. lnspection ScopeInspection PlanningThe inspectors reviewed all licensee performance indicators (Pls) for the OccupationalExposure cornerstone for follow up and reviewed the results of the most recent radiationprotection program audit.Contamination and Radioactive Material ControlThe inspectors selected three sealed sources from the licensee's inventory records,verified that the sources were accounted for, and have been leak tested within the pastsix months. The inspectors verified that there have not been any source transfertransactions since the last inspection involving nationally tracked sources.Radioloqical Hazards Control and Work CoverareDuring tours of the facility and review of ongoing work, the inspectors evaluated ambientradiological conditions, verified that existing conditions were consistent with postedsuryeys, RWPs, and worker briefings, as applicable. During available job performanceobservations, the inspectors verified the adequacy of radiological controls, radiationEnclosure 23protection job coverage, contamination controls, and evaluated the licensee's use ofelectronic pocket dosimeters in high noise areas. The inspectors verified thatdosimeters of legal record were being placed on the individual's body consistent withmonitoring the highest expected dose due to external radiation sources.During this inspection, there were no active work activities within airborne radioactivityareas with the potentialfor individual worker internal exposures for evaluation. Theinspectors examined the licensee's physical and programmatic controls for highlyactivated or contaminated materials (nonfuel) stored within spent fuel and other storagepools and verified that appropriate controls were in place to preclude inadvertentremoval of these materials from the pools. The inspectors conducted selectiveinspection of posting and physical controls for high radiation areas (HRAs) and very highradiation areas (VHRAs) to verify conformance with TS and procedural requirements.Risk Siqnificant Hiqh Radiation Area and Verv Hiqh Radiation Area ControlsThe inspectors reviewed the controls and procedures for high risk HRAs and VHRAS.The inspectors verified that any changes to licensee procedures did not substantiallyreduce the effectiveness and level of worker protection. The inspectors discussed with ahealth physics supervisor the controls in place for special areas that have the potential tobecome VHRAs during certain plant operations to determine if these plant operationsinclude prior communication with the HP organization to allow for timely actions toproperly post, control, and monitor the radiation hazards including re-accessauthorization.Radiation Worker PerformanceDuring job performance observations, the inspectors observed radiation workerperformance with respect to radiation work permit requirements to determine if workersare aware of the radiological conditions in their workplace and if their work performancereflects the conditions of the radiation work permit requirements. The inspectorsreviewed several radiological problem reports since the last inspection that include thecause of the event to be attributable to human performance errors. This review includeda determination of any similar observable patterns and effectiveness review of any priorcorrective actions taken by the licensee to resolve any similar prior radiologicalproblems.Radiation Protection Technician ProficiencvDuring job performance obseryations, the inspectors observed the performance ofradiation protection technicians with respect to applicable radiation work permitrequirements to determine if technicians were aware of the radiological conditions intheir workplace, the RWP controls/limits in place and if their performance was consistentwith their training and qualifications with respect to the radiological hazards and workactivities. The inspectors reviewed several radiological problem reports since the lastinspection that include the cause of the event to be attributable to radiation protectiontechnician error. This review included a determination of any similar observable patternsand effectiveness review of any prior corrective actions taken by the licensee to resolveany similar prior radiological problems.Enclosure b.a.2RS224Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one sample as defined in NRC InspectionProcedure 71124.01.FindinqsNo findings were identified.OccupationalALARA Planninq and Controls (71124.02 - 1 sample)Inspection ScopeInspection PlanninoThe inspectors reviewed site procedures associated with maintaining occupationalexposures ALARA, including a review of processes used to estimate and trackexposures from specific work activities.Radioloqical Work PlanninqBased on radiation work permit outage work activity collective exposure results from theUnit 2 Spring 2010 refueling outage, the inspectors selected for review those workactivities that resulted in a dose of 5 person-rem or greater. This review included thebasis of the exposure estimates with reference to historical performance metrics, andexposure mitigation requirements planned for these outage tasks.With respect to the outage work activity samples, the inspectors compared the actualexposure results with the estimated exposure established in the licensee's ALAM plansfor these work activities. The inspectors also compared the person-hour estimatesprovided by maintenance planning and other groups to the radiation protection groupwith the work activity person-hour actual results, to evaluate the performance results.The inspectors determined the reasons (e.9., failure to adequately plan the activity,failure to provide sufficient work controls) for any inconsistencies between intended andactual work activity doses. The inspectors also determined if any identified exposureoverrun causes were identified and entered into Entergy's CAP.Verification of Dose Estimates and Exposure Trackinq SvstemsThe Unit 2 Spring refueling outage ALARA work packages that resulted in greater than 5person-rem were reviewed to include the assumptions and basis (including dose rateand man-hour estimates) for their collective exposure estimates. Applicable procedureswere reviewed to determine the methodology for estimating exposures for specific workactivities and determining the intended dose outcome.The inspectors verified for the selected work activities that the licensee has establishedmeasures to track, trend, and if necessary to reduce, occupational doses for ongoingwork activities and that criteria are established to prompt additional reviews and/oradditionalALARA planning and controls. The inspectors evaluated the licensee'smethod of adjusting exposure estimates when unexpected changes in scope oremergent work were encountered. The inspectors determined if adjustments toEnclosure b..125exposure estimates (intended dose)were based on sound radiation protection andALARA principles or if they were only adjusted to account for failures to control the work.Source TeJn Reduction and ControlThrough a review of licensee records, the inspectors evaluated the historical trends andcurrent status of significant tracked plant source terms known to contribute to elevatedfacility aggregate exposure and reviewed the licensee's contingency plans for expectedchanges in the source term as the result of changes in plant fuel performance issues orchanges in plant primary chemistry.Radiation Worker PerformanceThe inspectors observed radiation worker and radiation protection technicianperformance during work activities being performed in radiation areas and high radiationareas. The inspectors determined if workers demonstrated the ALARA philosophy inpractice and whether there were any procedure compliance issues and whether thetraining and skill level of the radiation workers was sufficient with respect to theradiological hazards and the work tasks involved.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one sample as defined in NRC InspectionProcedure 71124.02.FindingsInadequate Work Planninq Control Relative to_Beqenerative Heat E4ghanqer Permanen!Shieldinq Modiflgation That Resulted jn Additional Unplanned Collective Exposulelntroduction. A Green self-revealing finding was identified because Entergy personneldid not adequately plan and control work activities related to a regenerative heatexchanger permanent shielding modification in accordance with RWP 20102537, "2R19Permanent Regenerative Heat Exchanger Shielding" which resulted in significantunplanned exposure.Desplription. During Refueling Outage 19, Entergy's RWP 20102537 provided theALARA plan and dose estimate standard for the regenerative heat exchanger permanentshielding modification. The regenerative heat exchanger permanent shieldingmodification dose exceeded the planned dose estimate in RWP 20102537. Entergypersonnel determined the dose estimates were exceeded due to inadequate workactivity planning and control. The lack of in-field walkdowns prior to designing themodification resulted in as-found interferences, and due to limited field supervision, theresulting construction modification was performed in a posted high radiation area. lnaddition, the construction workers performing the work did not have an assigned projectlead to direct the in-field work, which resulted in delays in completing the modificationwithin time estimates as assumed in the dose planning. These factors resulted inadditional collective exposure that Entergy could have reasonably avoided had sufficientwork activity planning and additional in-field supervision occurred.The inspectors reviewed RWP 20102537 and determined the actualjob site conditionsfor installation of the regenerative heat exchanger permanent shielding were notEnclosure 26adequately evaluated for interferences and when revealed, measures were not taken byEntergy personnel to prefabricate the modifications outside of a high radiation area,resulting in additional unnecessary personnel exposure. The original exposure workestimate was 6.8 person-rem. In order to provide allowance for higher dose rates thananticipated, the original estimate was increased to 8.0 person-rem, however the actualwork activity exposure was 17
lt is also similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E,"Examples of Minor lssues," since it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an ALARA planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007-2009).


===.189 person-rem (115To greater than the revised exposureestimate). This issue was entered into Entergy's CAP as CR-IP2-2010-02817.Analvsis. The performance deficiency associated with this finding was that Entergypersonnel did not adequately plan and controlwork activities related to a regenerativeheat exchanger permanent shielding modification in accordance with RWP 20102537.This finding is more than minor because it is associated with the program and processattribute of the Occupational Radiation Safety cornerstone and affected the cornerstoneobjective of ensuring the adequate protection of the worker health and safety fromexposure to radiation from radioactive material during routine reactor operations. lt isalso similar to the more than minor example 6,j provided in IMC 0612, "Power Reactorlnspection Reports," Appendix E, "Examples of Minor lssues," since it involves an actualcollective exposure greater than 5 person-rem and exceeded the planned, intendeddose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety SignificanceDetermination Process," the finding was determined to have very low safety significance(Green) because the finding involved an ALARA planning issue and the 3-year rollingaverage collective dose history was less than 135 person-rem (52.261 person-remaverage annual exposure for 2007-2009).The finding has a cross-cutting aspect in the area of human performance associatedwith the work control attribute because Entergy's planned work activities did notadequately incorporate the job site interferences and their resolution in accordanceradiological safety. [H.3(a) per IMC 0310]Enforcement. This finding does not involve enforcement action because no regulatoryrequirement violation was identified. Because this finding does not involve a violation,has very low safety significance, and was entered into Entergy's CAP as CR-lP2-2010-02817, it is identified as a finding: FIN 0500024712010005-02, Inadequate WorkPlanning Gontrol Retative to Regenerative Heat Exchanger Permanent ShieldingModification That Resulted in Additional Unplanned Gollective Exposure.lnadequate Work Coordination Relative to Reactor Cavitv Liner Repair That Resulted inAdditional Unplanned Collg;tive Expg.sureIntroduction. A Green self-revealing finding was identified because Entergy personneldid not adequately plan and controlwork activities related to reactor cavity liner repair inaccordance with RWP 20102530, "2R19 Cavity Liner Repair" which resulted insignificant unplanned collective exposure.Description. During Refueling Outage 19, Entergy's RWP 20102530 provided theALARA plan and dose estimate standard for the work activity. The Unit 2 reactor cavityliner repair dose exceeded the planned dose estimate in RWP 20102530. Entergypersonnel determined the dose estimate was exceeded due to inadequate workcoordination and ALARA plan implementation. Schedule delays resulted in the intended.2Enclosure===
The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy did not coordinate and implement work activities as planned, keeping personnel apprised of work status and schedule delays, which resulted in significant dose overrun. tH.3(b) per IMC 03101


27contractor vendor not being able to conduct the work as planned, resulting in the use ofback-up workers to perform the cavity sealant removalwork, which resulted in additionalperson-hours to complete this work. Also due to schedule delays, the reactor headshielding was removed while the cavity liner repair work was still in progress, whichresulted in higher than planned exposures. In addition, due to the delayed andcompressed schedule, the planned shielding for the cavity boring work was not appliedas planned, which resulted in higher exposures.The inspectors reviewed RWP 20102530 and determined the additional person-hours toperform the reactor cavity sealant removal, the removal of reactor head shielding, andfailure to provide the planned cavity boring shielding resulted in additional collectiveexposure that could have been avoided had sufficient work coordination and work planimplementation been performed. The original exposure work estimate was 3.09 person-rem. For purposes of this analysis, in order to provide allowance for higher dose ratesthan anticipated, the original estimate was increased to 3.635 person-rem. Whencompared to the actual work activity exposure of 7.058 person-rem, the results were94% greater than the revised exposure estimate. This issue was entered into Entergy'sCAP as CR-!P2-201 0-02817 .Analvsis. The performance deficiency associated with this finding was that Entergypersonnel did not adequately plan and controlwork activities related to the reactor cavityliner repair in accordance with RWP 20102530. This finding is more than minor becauseit is associated with the program and process attribute of the Occupational RadiationSafety cornerstone and affected the cornerstone objective of ensuring the adequateprotection of the worker health and safety from exposure to radiation from radioactivematerial during routine reactor operations. lt is also similar to the more than minorexample 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E,"Examples of Minor lssues," since it involves an actual collective exposure greater than5 person-rem and exceeded the planned, intended dose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety SignificanceDetermination Process," the finding was determined to have very low safety significance(Green) because the finding involved an ALARA planning issue and the 3-year rollingaverage collective dose history was less than 135 person-rem (52.261 person-remaverage annual exposure for 2007-2009).The finding has a cross-cutting aspect in the area of human performance associatedwith the work control attribute because Entergy did not coordinate and implement workactivities as planned, keeping personnel apprised of work status and schedule delays,which resulted in significant dose overrun. tH.3(b) per IMC 03101Enforcement. This finding does not involve enforcement action because no regulatoryrequirement violation was identified. Because this finding does not involve a violation,has very low safety significance, and it was entered into Entergy's CAP as CR-IP2-2Q10-02817, it is identified as a findingr FIN 0500024712010005-03, Inadequate WorkCoordination Relative to Reactor Gavity Liner Repair That Resulted in AdditionalUnplanned Collective Exposure.Enclosure  
=====Enforcement.=====
This finding does not involve enforcement action because no regulatory requirement violation was identified.
 
Because this finding does not involve a violation, has very low safety significance, and it was entered into Entergy's CAP as CR-IP2-2Q10-02817, it is identified as a findingr FIN 0500024712010005-03, Inadequate Work Coordination Relative to Reactor Gavity Liner Repair That Resulted in Additional Unplanned Collective Exposure.Enclosure  


==OTHER ACTIVITIES==
==OTHER ACTIVITIES==
{{a|4OA1}}
{{a|4OA1}}
==4OA1 Performance lndicator Verification (71151- 5 samples)==
==4OA1 Performance==
.1 Mitiqatinq Svstems Performance Index - Heat Removal Svstem (MS08)a. Inspection ScopeThe inspectors sampled Entergy submittals for the mitigating systems performanceindex - heat removal system Pl for the period from October 2009 through September2010. To determine the accuracy of the Pl data reported during those periods, theinspectors used definitions and guidance contained in Nuclear Energy lnstitute (NEl)Document 99-02, "Regulatory Assessment Performance Indicator Guideline." Theinspectors reviewed the licensee's operator narrative logs, issue reports, event reports,mitigating systems performance index derivation reports, and NRC integrated inspectionreports to validate the accuracy of the submittals. The inspectors also reviewedEntergy's issue report database to determine if any problems had been identified withthe Pl data collected or transmitted for this indicator and none were identified.Specific documents reviewed are described in the attachment to this report. Theseactivities constitute completion of one mitigating systems performance index - heatremoval system sample as defined in NRC lnspection Procedure 71151.A correction fo NRC lnspection Report 05000247/2010004 dated November 10, 2010:Mitigating Sysfems Performance lndex - Residual Heat Removal System (M509) wasreviewed instead of Heat RemovalSysfem (M508).FindinosNo findings were identified.Mitioatinq Svstems Performance Index - Coolinq Water Svstems (MS10)lnspgction ScopeThe inspectors sampled Entergy submittals for the mitigating systems performanceindex - cooling water systems for the period from October 2009 through September2010. To determine the accuracy of the Pl data reported during those periods, theinspectors used definitions and guidance contained in NEI Document 99-02, "RegulatoryAssessment Performance Indicator Guideline." The inspectors reviewed Entergy'soperator narrative logs, issue reports, event reports, mitigating systems performanceindex derivation reports, and NRC integrated inspection reports to validate the accuracyof the submittals. The inspectors also reviewed Entergy's issue report database todetermine if problems had been identified with the Pl data collected or transmitted forthis indicator and none were identified.Specific documents reviewed are described in the attachment to this report. Theseactivities constitute completion of one mitigating systems performance index - coolingwater systems sample as defined in NRC Inspection Procedure 71151..2a.Enclosure
 
lndicator Verification (71151- 5 samples).1 Mitiqatinq Svstems Performance Index - Heat Removal Svstem (MS08)a. Inspection Scope The inspectors sampled Entergy submittals for the mitigating systems performance index - heat removal system Pl for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in Nuclear Energy lnstitute (NEl)Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed the licensee's operator narrative logs, issue reports, event reports, mitigating systems performance index derivation reports, and NRC integrated inspection reports to validate the accuracy of the submittals.
 
The inspectors also reviewed Entergy's issue report database to determine if any problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.
 
Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one mitigating systems performance index - heat removal system sample as defined in NRC lnspection Procedure 71151.A correction fo NRC lnspection Report 05000247/2010004 dated November 10, 2010: Mitigating Sysfems Performance lndex - Residual Heat Removal System (M509) was reviewed instead of Heat RemovalSysfem (M508).Findinos No findings were identified.
 
Mitioatinq Svstems Performance Index - Coolinq Water Svstems (MS10)lnspgction Scope The inspectors sampled Entergy submittals for the mitigating systems performance index - cooling water systems for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in NEI Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed Entergy's operator narrative logs, issue reports, event reports, mitigating systems performance index derivation reports, and NRC integrated inspection reports to validate the accuracy of the submittals.
 
The inspectors also reviewed Entergy's issue report database to determine if problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.
 
Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one mitigating systems performance index - cooling water systems sample as defined in NRC Inspection Procedure 71151..2 a.Enclosure
 
===.3 b.a.29 Findinqs No findings were identified.===
 
Reactor Coolant Svstem Leakaqe (8102)Inspection Scope The inspectors sampled Entergy submittals for RCS leakage Pl for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in NEI Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed the licensee's operator narrative logs, issue reports, event reports, and NRC integrated inspection reports to validate the accuracy of the submittals.
 
The inspectors also reviewed Entergy's issue report database to determine if any problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.
 
Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one RCS leakage sample as defined in NRC lnspection Procedure 7 1151.Findinqs No findings were identified.
 
Occupational Exposure Control Effectiveness Inspection Scope The inspectors reviewed implementation of Entergy's Occupational Exposure Control Effectiveness Pl Program. Specifically, the inspectors reviewed CRs, and radiological controlled area dosimeter exit logs for the past four calendar quarters (through 3rd quarter 2010). These records were reviewed for occurrences involving locked high radiation areas, very high radiation areas, and unplanned exposures against the criteria specified in NEI 99-02, "Regulatory Assessment Performance Indicator Guideline," to verify that all occurrences that met the NEI criteria were identified and reported as Pls.Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one occupational exposure control effectiveness sample as defined in NRC Inspection Procedure 71151.Findinos No findings were identified.
 
b..4 b.Enclosure
 
===.5 30 Radioloqical===
 
Effluent Technical Specification (RETS)/Offsite Dose Calculglion Manual (ODCM) Radioloqical Effluent Opcurrences Inspection Scope The inspectors reviewed a listing of relevant effluent release reports for the past four (4)calendar quarters (through 3rd quarter 2010), for issues related to the public radiation safety Pl, which measures radiological effluent release occurrences per site that exceed 1,5 mrem/quarter whole body or 5.0 mrem/quarter organ dose for liquid effluents; 5 mrads/quarter gamma air dose, 10 mrad/quarter beta air dose, and 7.5 mrads/quarter for organ dose for gaseous effluents.
 
The review was against applicable criteria specified in NEI 99-02, "Regulatory Assessment Performance Indicator Guideline." The purpose of the review was to verify that occurrences that met the NEI criteria were recognized and identified as Pl occurrences.
 
The inspectors reviewed the following documents to ensure the licensee met all requirements of the Pl:. Monthly prolected dose assessment results due to radioactive liquid and gaseous effluent releases;. Quarterly projected dose assessment results due to radioactive liquid and gaseous effluent releases; and. Dose assessment procedures.
 
Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one RETS/ODCM radiological effluent occurrences sample as defined in NRC Inspection Procedure 71151.Findinqs No findings were identified.
 
ldentification and Resolution of Problems (71152 - 2 samples)Routine Review of Problem ldentification and Resolution Activities Inspection Scope As required by Inspection Procedure7l152, "ldentification and Resolution of Problems," the inspectors routinely reviewed issues during baseline inspection activities and plant status reviews to verify that issues were being entered into Entergy's CAP at an appropriate threshold, that adequate attention was being given to timely corrective actions, and that adverse trends were identified and addressed.
 
In order to assist with the identification of repetitive equipment failures and specific human performance issues for follow-up, the inspectors performed a daily screening of items entered into the CAP.The inspectors reviewed attributes that included:
(1) complete and accurate identification of the problem; (2) timely correction, commensurate with the safety significance; (3)evaluation and disposition of performance issues, generic implications, common causes, contributing factors, root causes, extent of condition reviews, and previous occurrences reviews; and (4) classification, prioritization, focus, and timeliness of corrective actions.These routine reviews for the identification and resolution of problems did not constitute any additional inspection samples. Instead, by procedure, they were considered an b.4c.42.1 a.Enclosure b.a..2 31 integral part of the inspections performed during the quarter. Specific documents reviewed during this inspection are listed in the attachment.
 
Findinqs No findings were identified.
 
Semi-Annual Trgnd Review Inspection Scope The inspectors performed a semi-annual review of site issues, to identify trends that might indicate the existence of more significant safety issues, as required by Inspection Procedure 7l152, "ldentification and Resolution of Problems." The inspectors included in this review, repetitive or closely related issues that may have been documented by Entergy outside of the CAP, such as trend reports, Pls, major equipment problem lists, system health reports, maintenance rule assessments, and maintenance or CAP backlogs.
 
The inspectors also reviewed the Entergy CAP database for the first and second quarters o12010, to assess CRs written in various subject areas (equipment problems, human performance issues), as well as individual issues identified during the NRCs daily CR review (Section 4OA2.1). The inspectors reviewed the Entergy quarterly trend report for the first quarter of 2010, conducted under LO-IP3LO-2010-00049 to verify that Entergy personnelwere appropriately evaluating and trending adverse conditions in accordance with applicable procedures.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one in-depth problem identification and resolution sample as defined in NRC Inspection Procedure 71152.Findinqs and Observations No findings of significance were identified.
 
The inspectors evaluated a sample of departments that are required to provide input into the quarterly trend reports, which included system engineering and operations departments.
 
This review included a sample of issues and events that occurred over the course of the past two quarters to objectively determine whether issues either were appropriately considered or ruled as emerging or adverse trends, and in some cases, verified the appropriate disposition of resolved trends. The inspectors verified that these issues were addressed within the scope of the CAP, or through department review and documentation in the quarterly trend report for overall assessment.
 
For example, the inspectors noted that consistent with an increase in the human performance error rate that Entergy personnel had appropriately identified "human performance error rate" as a monitored trend with ongoing corrective actions to address this long-standing issue. In other cases, the inspectors verified for resolved trends, such as vital area door hardware deficiencies, that applicable success criteria were identified to ensure successful resolution of adverse trends.Additionally, the inspectors noted an apparent increase in the CRs associated with the decreasing pressure in the Sl tanks, and while a sample review indicated Entergy plans further troubleshooting of this issue, the cause of the decreasing pressure has not been b.Enclosure
 
===.3 a.32 identified.===
 
The inspectors reviewed the trend and determined Entergy personnel had appropriately developed WOs to troubleshoot this issue and no current operability issue existed because Sl tank pressure was within the required band.The inspectors also observed an apparent increase in the number of inadequacies with operability determinations.
 
The inspectors noted some operability determinations included insufficient detail to prove operability of safety-related components without further discussions with operations and engineering personnel.
 
For example, CR-IP2-2010-05173 and CR-lP2-2010-07232 for fuel oil leaks on the 22 and 23 emergency diesel generators did not provide sufficient information to ensure adequate fuel oil was available during a design basis accident for the mission time of the diesels with these fuel oil leaks. These operability determinations were revised and addressed in common CR, CR-IP3-2A10-02576.
 
Also, CR-lP2-2010-05378 for a 23 battery charger ground did not provide an operability determination until questioned by the inspectors.
 
An operability determination was performed to ensure the 23 battery charger would perform as designed with these grounds. Since no equipment was actually inoperable, and there was no appreciable reduction in safety margin, these issues are considered minor. The inspectors noted that these inadequate operability determinations had not been recognized by Entergy staff as a specific emerging or adverse trend.Annual Sample - Aqqreqate lmpact of Operator Workaroqnds lnspection Scope The inspectors conducted a review of the aggregate impact of operator burdens and workarounds.
 
The inspectors reviewed Entergy's implementation of procedures OAP-45, "Qperator Burden Program." The inspectors conducted control room walkdowns and interviewed plant operators to determine the impact of deficiencies on operator response to plant events. Additionally, the inspectors reviewed operator logs, CRs and performed system walkdowns to verify that there were no risk significant operator actions that had not been evaluated by Entergy personnel.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one in-depth problem identification and resolution sample as defined in NRC lnspection Procedure 71152.Findinqs and Observations No findings were identified.
 
The inspectors verified that operator workarounds and burdens were entered into the CAP at an appropriate threshold and that corrective actions were planned or taken commensurate with their safety significance.
 
b.Enclosure


===.3 b.a.29FindinqsNo findings were identified.Reactor Coolant Svstem Leakaqe (8102)Inspection ScopeThe inspectors sampled Entergy submittals for RCS leakage Pl for the period fromOctober 2009 through September 2010. To determine the accuracy of the Pl datareported during those periods, the inspectors used definitions and guidance contained inNEI Document 99-02, "Regulatory Assessment Performance Indicator Guideline." Theinspectors reviewed the licensee's operator narrative logs, issue reports, event reports,and NRC integrated inspection reports to validate the accuracy of the submittals. Theinspectors also reviewed Entergy's issue report database to determine if any problemshad been identified with the Pl data collected or transmitted for this indicator and nonewere identified.Specific documents reviewed are described in the attachment to this report. Theseactivities constitute completion of one RCS leakage sample as defined in NRClnspection Procedure 7 1151.FindinqsNo findings were identified.Occupational Exposure Control EffectivenessInspection ScopeThe inspectors reviewed implementation of Entergy's Occupational Exposure ControlEffectiveness Pl Program. Specifically, the inspectors reviewed CRs, and radiologicalcontrolled area dosimeter exit logs for the past four calendar quarters (through 3rdquarter 2010). These records were reviewed for occurrences involving locked highradiation areas, very high radiation areas, and unplanned exposures against the criteriaspecified in NEI 99-02, "Regulatory Assessment Performance Indicator Guideline," toverify that all occurrences that met the NEI criteria were identified and reported as Pls.Specific documents reviewed are described in the attachment to this report. Theseactivities constitute completion of one occupational exposure control effectivenesssample as defined in NRC Inspection Procedure 71151.FindinosNo findings were identified.b..4b.Enclosure===
===.4 a.33 (Closed) Unresolved===


===.530 Radioloqical Effluent Technical Specification (RETS)/Offsite Dose Calculglion Manual(ODCM) Radioloqical Effluent OpcurrencesInspection ScopeThe inspectors reviewed a listing of relevant effluent release reports for the past four (4)calendar quarters (through 3rd quarter 2010), for issues related to the public radiationsafety Pl, which measures radiological effluent release occurrences per site that exceed1,5 mrem/quarter whole body or 5.0 mrem/quarter organ dose for liquid effluents; 5mrads/quarter gamma air dose, 10 mrad/quarter beta air dose, and 7.5 mrads/quarter fororgan dose for gaseous effluents. The review was against applicable criteria specified inNEI 99-02, "Regulatory Assessment Performance Indicator Guideline." The purpose ofthe review was to verify that occurrences that met the NEI criteria were recognized andidentified as Pl occurrences. The inspectors reviewed the following documents toensure the licensee met all requirements of the Pl:. Monthly prolected dose assessment results due to radioactive liquid and gaseouseffluent releases;. Quarterly projected dose assessment results due to radioactive liquid and gaseouseffluent releases; and. Dose assessment procedures.Specific documents reviewed are described in the attachment to this report. Theseactivities constitute completion of one RETS/ODCM radiological effluent occurrencessample as defined in NRC Inspection Procedure 71151.FindinqsNo findings were identified.ldentification and Resolution of Problems (71152 - 2 samples)Routine Review of Problem ldentification and Resolution ActivitiesInspection ScopeAs required by Inspection Procedure7l152, "ldentification and Resolution of Problems,"the inspectors routinely reviewed issues during baseline inspection activities and plantstatus reviews to verify that issues were being entered into Entergy's CAP at anappropriate threshold, that adequate attention was being given to timely correctiveactions, and that adverse trends were identified and addressed. In order to assist withthe identification of repetitive equipment failures and specific human performance issuesfor follow-up, the inspectors performed a daily screening of items entered into the CAP.The inspectors reviewed attributes that included: (1) complete and accurate identificationof the problem; (2) timely correction, commensurate with the safety significance; (3)evaluation and disposition of performance issues, generic implications, common causes,contributing factors, root causes, extent of condition reviews, and previous occurrencesreviews; and (4) classification, prioritization, focus, and timeliness of corrective actions.These routine reviews for the identification and resolution of problems did not constituteany additional inspection samples. Instead, by procedure, they were considered anb.4c.42.1a.Enclosure===
ltem 05Q9@422010-002-02, &eluelino Cavitv Leakaqe rnLo Conteinment Inspection Ssope The inspectors completed an evaluation of unresolved item (URl) 0500024712010002-02 regarding historical refueling cavity leakage into containment that occurs during reactor refueling activities for approximately two weeks every other year. The URI documented that, during refueling outages from 1993 to the present, borated water (containing approximately 2700 ppm boric acid) had leaked from the reactor refueling cavity into the lowest level of containment at a rate of two to ten gallons per minute. The URI was opened because inspectors concluded additional information was required from Entergy personnel related to their assessment of this condition.


b.a..231integral part of the inspections performed during the quarter. Specific documentsreviewed during this inspection are listed in the attachment.FindinqsNo findings were identified.Semi-Annual Trgnd ReviewInspection ScopeThe inspectors performed a semi-annual review of site issues, to identify trends thatmight indicate the existence of more significant safety issues, as required by InspectionProcedure 7l152, "ldentification and Resolution of Problems." The inspectors includedin this review, repetitive or closely related issues that may have been documented byEntergy outside of the CAP, such as trend reports, Pls, major equipment problem lists,system health reports, maintenance rule assessments, and maintenance or CAPbacklogs. The inspectors also reviewed the Entergy CAP database for the first andsecond quarters o12010, to assess CRs written in various subject areas (equipmentproblems, human performance issues), as well as individual issues identified during theNRCs daily CR review (Section 4OA2.1). The inspectors reviewed the Entergy quarterlytrend report for the first quarter of 2010, conducted under LO-IP3LO-2010-00049 toverify that Entergy personnelwere appropriately evaluating and trending adverseconditions in accordance with applicable procedures.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one in-depth problem identification and resolutionsample as defined in NRC Inspection Procedure 71152.Findinqs and ObservationsNo findings of significance were identified.The inspectors evaluated a sample of departments that are required to provide input intothe quarterly trend reports, which included system engineering and operationsdepartments. This review included a sample of issues and events that occurred over thecourse of the past two quarters to objectively determine whether issues either wereappropriately considered or ruled as emerging or adverse trends, and in some cases,verified the appropriate disposition of resolved trends. The inspectors verified that theseissues were addressed within the scope of the CAP, or through department review anddocumentation in the quarterly trend report for overall assessment. For example, theinspectors noted that consistent with an increase in the human performance error ratethat Entergy personnel had appropriately identified "human performance error rate" as amonitored trend with ongoing corrective actions to address this long-standing issue. Inother cases, the inspectors verified for resolved trends, such as vital area door hardwaredeficiencies, that applicable success criteria were identified to ensure successfulresolution of adverse trends.Additionally, the inspectors noted an apparent increase in the CRs associated with thedecreasing pressure in the Sl tanks, and while a sample review indicated Entergy plansfurther troubleshooting of this issue, the cause of the decreasing pressure has not beenb.Enclosure
The central item discussed in the URI was that Entergy technical staff had not evaluated the impact of the borated refueling cavity water on the dissimilar metal welds between the stainless steel liner and the carbon steel studs that attach the liner to the concrete wall. ln addition, the inspectors evaluated whether the Entergy corrective action process was appropriately implemented for identifying, evaluating, and resolving this issue.The inspectors met with Entergy personnel to discuss the open item described above.Entergy personnel provided the inspectors with an engineering evaluation to address the central issue of the URI - the impact of the borated water on the liner attachment welds and carbon steel hardware.


===.3 a.32identified. The inspectors reviewed the trend and determined Entergy personnel hadappropriately developed WOs to troubleshoot this issue and no current operability issueexisted because Sl tank pressure was within the required band.The inspectors also observed an apparent increase in the number of inadequacies withoperability determinations. The inspectors noted some operability determinationsincluded insufficient detail to prove operability of safety-related components withoutfurther discussions with operations and engineering personnel. For example, CR-IP2-2010-05173 and CR-lP2-2010-07232 for fuel oil leaks on the 22 and 23 emergencydiesel generators did not provide sufficient information to ensure adequate fuel oil wasavailable during a design basis accident for the mission time of the diesels with thesefuel oil leaks. These operability determinations were revised and addressed in commonCR, CR-IP3-2A10-02576. Also, CR-lP2-2010-05378 for a 23 battery charger ground didnot provide an operability determination until questioned by the inspectors. Anoperability determination was performed to ensure the 23 battery charger would performas designed with these grounds. Since no equipment was actually inoperable, and therewas no appreciable reduction in safety margin, these issues are considered minor. Theinspectors noted that these inadequate operability determinations had not beenrecognized by Entergy staff as a specific emerging or adverse trend.Annual Sample - Aqqreqate lmpact of Operator Workaroqndslnspection ScopeThe inspectors conducted a review of the aggregate impact of operator burdens andworkarounds. The inspectors reviewed Entergy's implementation of procedures OAP-45, "Qperator Burden Program." The inspectors conducted control room walkdowns andinterviewed plant operators to determine the impact of deficiencies on operator responseto plant events. Additionally, the inspectors reviewed operator logs, CRs and performedsystem walkdowns to verify that there were no risk significant operator actions that hadnot been evaluated by Entergy personnel.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one in-depth problem identification and resolutionsample as defined in NRC lnspection Procedure 71152.Findinqs and ObservationsNo findings were identified.The inspectors verified that operator workarounds and burdens were entered into theCAP at an appropriate threshold and that corrective actions were planned or takencommensurate with their safety significance.b.Enclosure===
Entergy personnel also provided the inspectors with information and documentation to address related inspector questions.


===.4 a.33(Closed) Unresolved ltem 05Q9@422010-002-02, &eluelino Cavitv Leakaqe rnLoConteinmentInspection SsopeThe inspectors completed an evaluation of unresolved item (URl) 0500024712010002-02regarding historical refueling cavity leakage into containment that occurs during reactorrefueling activities for approximately two weeks every other year. The URI documentedthat, during refueling outages from 1993 to the present, borated water (containingapproximately 2700 ppm boric acid) had leaked from the reactor refueling cavity into thelowest level of containment at a rate of two to ten gallons per minute. The URI wasopened because inspectors concluded additional information was required from Entergypersonnel related to their assessment of this condition. The central item discussed inthe URI was that Entergy technical staff had not evaluated the impact of the boratedrefueling cavity water on the dissimilar metal welds between the stainless steel liner andthe carbon steel studs that attach the liner to the concrete wall. ln addition, theinspectors evaluated whether the Entergy corrective action process was appropriatelyimplemented for identifying, evaluating, and resolving this issue.The inspectors met with Entergy personnel to discuss the open item described above.Entergy personnel provided the inspectors with an engineering evaluation to address thecentral issue of the URI - the impact of the borated water on the liner attachment weldsand carbon steel hardware. Entergy personnel also provided the inspectors withinformation and documentation to address related inspector questions. The inspectorsreviewed the information provided, conducted additional meetings with Entergypersonnel to determine whether Entergy technical staff had adequately provided thenecessary information for the inspectors to address closure of the URl. Further detailsof the inspectors' review of this URI are provided below.Findinqs a[d ObservationsThe URI documented that, during refueling outages from 1993 to the present, boratedwater had leaked from the reactor refueling cavity into the lowest level of containment ata rate of two to ten gallons per minute. Additional information from Entergy's CAPdocumented that the epoxy repairs performed in 1993 were effective, and there were nodocumented liner plate epoxy repair failures revealed until 2000.ln response to the URI (the impact of the borated water on the liner attachment weldsand carbon steel hardware), Entergy engineering personnel performed an engineeringevaluation that determined there were no structural concerns due to the leaking refuelingcavity water on liner welds and hardware. The evaluation was documented in Entergy'sCAP under CR-lP2-2008-01629. Specific data used by station personnel to reach thisconclusion included the results of several core bores that were taken from concrete andreinforcing steel, visual observations of the dissimilar welds and carbon steel hardware,results of water samples taken during 2R19 showing very low levels of chlorides, andresults of an EPRI study showing borated water does not aggressively attack carbonsteel in the temperature range to which these components are exposed.The inspectors reviewed Entergy's evaluation and determined that Entergy personnelhad adequately addressed the open item regarding the impact of the borated water onthe liner attachment welds and carbon steel hardware. Further, with respect to theb.Enclosure===
The inspectors reviewed the information provided, conducted additional meetings with Entergy personnel to determine whether Entergy technical staff had adequately provided the necessary information for the inspectors to address closure of the URl. Further details of the inspectors' review of this URI are provided below.Findinqs a[d Observations The URI documented that, during refueling outages from 1993 to the present, borated water had leaked from the reactor refueling cavity into the lowest level of containment at a rate of two to ten gallons per minute. Additional information from Entergy's CAP documented that the epoxy repairs performed in 1993 were effective, and there were no documented liner plate epoxy repair failures revealed until 2000.ln response to the URI (the impact of the borated water on the liner attachment welds and carbon steel hardware), Entergy engineering personnel performed an engineering evaluation that determined there were no structural concerns due to the leaking refueling cavity water on liner welds and hardware.


34structural integrity of the reactor cavity liner and concrete, the inspectors reviewed: 1)core samples that were taken from reactor cavity concrete structure; 2) photographs ofadditional core samples and imbedded rebar; and 3) the licensee and vendorevaluations including petro graphic examination of the concrete aggregate. Theinspectors also reviewed completed License Renewal actions as accepted by the NRCStaff's SER for various letters submitted by Entergy up to and including June 2009.Specifically, the following items for 2010 were reviewed and evaluated: 1) three coresamples of concrete from the observed leakage location to determine the compressivestrength of the concrete and pH value as well as boron and chloride concentration inconcrete and water; and 2) visual examination of the exposed reinforcements.The inspectors' independent review did not identify unusual indications or degradation ofconcrete and re-bar. The inspectors determined that core samples appeared asdescribed by Entergy personnel and the water chemistry was as expected. Theinspectors also noted the proper completion of license renewal commitments withrespect to concrete core samples and water chemistry analysis of 2010. Further, theinspectors reviewed the report lP-RPT-1 1-00002 regarding Entergy's conclusion that theReactor Fueling Cavity and the Fuel Handling Building Concrete retained the structuralcapacity to fulfill its design and safety function. The inspectors' review determined thatEntergy's evaluation was appropriate in its evaluation and conclusion that the designand safety function of the liner was maintained given the current condition and impactsregarding the leakage that occurs during refueling outages. The inspectors alsodiscussed Entergy's plan for the permanent fix and verified that if remediation isunsuccessful for the leakage, then Entergy's corrective action process has provisions tocontinue to re-inspect the concrete, re-bar, and the leaking water prior to extendedoperation.As part of the inspectors' corrective action review of this condition, which included reviewof plant drawings, inspectors questioned the safety classification of the refueling cavityliner. Entergy staff evaluated the liner classification as documented in EC 21400.Entergy staff's EC evaluation determined that the refueling cavity liner did not meet therequirements to be classified as a safety-related component. However, Entergyengineers determined the cavity liner met station requirements to be classified as anaugmented quality (QP) component, which is an SSC that is not safety-related but mayrequire additional quality level oversight. The Entergy QP designation imposes formalrequirements on liner design, materials, and work methods to maintain greater controlover liner-related activities. The inspectors reviewed the EC and verified Entergypersonnel had followed their procedures and processes for determining the safetyclassification of the liner.Additionally, inspectors questioned whether the wetted SSCs were being properlyaddressed in accordance with procedure EN-DC-319, "lnspection and Evaluation ofBoric Acid Leaks." The inspectors noted that procedure EN-DC-319 required, "For non-white, wet, or excessive leaks, a BAC [Boric Acid Corrosion] Evaluator shall evaluate theleak using guidance established in Attachment 9.4." The inspectors noted that, contraryto this procedural reguirement, Entergy technical staff had not completed anAttachment 9.4 evaluation for the wetted components in the 46 foot level of containment.Entergy personneldocumented this issue as CR-lP2-2010-02628 and completedAttachment 9.4. Using the EPRI Boric Acid Guidebook, engineering personnelcalculated the expected corrosion rates for the given temperature range and timeduration of exposure. The evaluation determined that, due to the moderateEnclosure 35temperatures and limited exposure time (wetting only occurs during cavity flood up,which is less than three weeks every two years), the pumps, valves, piping, associatedcomponents and their supports would not be significantly impacted by boric acidcorrosion. The inspectors reviewed Entergy's evaluation and determined that itadequately addressed the impact of the refueling cavity leakage on the equipment in the46 foot level of containment. In addition, the inspectors conducted several walkdowns ofthe 46 foot level of containment during 2R19 and verified that the SSCs were notexperiencing external corrosion due to the borated water. The inspectors also ensuredEntergy personnel were following procedure EN-DC-319 to review and evaluate any dryboric acid found on these components at the start of each refueling outage.The inspectors determined that not following the requirements of procedure EN-DC-319was a performance deficiency. Specifically, Entergy technical staff did not evaluate thewet boric acid leak on the 46 foot level of containment until questioned by the NRC. Theinspectors reviewed this performance deficiency in accordance with NRC IMC 0612Appendix B and determined that it constituted a performance deficiency of minorsignificance because there was no safety impact on equipment, and because Entergyengineers performed evaluations of the dry boric acid accumulated throughout the cycleat the beginning of each refueling outage.The inspectors further reviewed procedure EN-tl-102, "Corrective Action Process," Step5.2.e, which states, "Employees are required to initiate condition reports for adverseconditions." Attachment9.2 of this procedure gives examples of adverse conditionssuch as "Conditions affecting a safety related, quality related or trip sensitive systemcaused by a deficiency in characteristic, documentation or procedure that renders thequality of an item unacceptable or indeterminate. The inspectors reviewed procedureEN-OP-104, "Operability Determination Process," Step 5.1.5, "SSCs warrantfunctionality assessments within the processes used to address degraded andnonconforming conditions because they perform specified safety functions described inthe UFSAR." The UFSAR Section 9.5.1.4, "Protection Against Radioactivity Releasefrom Spent Fuel and Waste Storage," states, "The reactor cavity, refueling canal andspent fuel storage pit are reinforced concrete structures with a seam-welded stainlesssteel plate liner. These structures are designed to withstand the anticipated earthquakeloadings as seismic Class I structures so that the liner prevents leakage even in theevent the reinforced concrete develops cracks."The inspectors identified a performance deficiency because Entergy personnel did notfully implement procedures EN-Ll-102 and EN-OP-104. Specifically, while conditionreports were initiated for the leak each refueling outage when they occurred, Entergypersonnel did not perform a functional assessment to evaluate the reactor cavity linerleakage each refueling outage when the condition existed. Entergy personnel initiatedCR-lP2-2010-06741 and conducted a past functionality assessment. Entergy personneldetermined that the leakage condition, when present, was a condition not consistent withthe reactor cavity liner's UFSAR described design function; however, Entergy personneldetermined the leakage condition did not have a safety impact on the liner's functionality.The inspectors reviewed this performance deficiency in accordance with IMC 0612Appendix B and determined that it constituted a performance deficiency of minorsignificance because the non-conforming leakage condition did not have a safety impacton the equipment or the liner attachment welds and carbon steel hardware that supportliner functionality. Entergy personnel have developed a recurring step in the outage planto write a condition report and evaluate the leaking condition, until repaired, to ensureEnclosure
The evaluation was documented in Entergy's CAP under CR-lP2-2008-01629.


===.536 there is no impact on equipment. This recurring task is documented in LO-OLl-2010-00140. Entergy personnel continue to implement and evaluate corrective actions (CR-lP2-2008-01629) to correct the liner leakage and restore the condition of the liner to asdescribed in the UFSAR.ln general, based on the review of Entergy's corrective actions for the reactor cavity linerleakage condition, the inspectors concluded that Entergy personnel are following theirCAP for evaluating and resolving the leakage. Entergy staff prioritized this issuecommensurate with the safety significance of the problem, and for the long termcorrective actions, is performing the required yearly periodic assessment. Stationpersonnel have been following their process for identifying and evaluating the dry boricacid residue in accordance with procedure EN-DC-319. However, as described above,the inspectors determined that each refueling outage, site personnel did not specificallyscreen the leakage appropriately for liner functionality and evaluate the interim wet boricacid conditions.The inspectors have completed their review of URI 0500024712010002-02. Two minorperformance deficiencies were identified as noted above. Specific documents reviewedduring this inspection are listed in the attachment. This URI is closed.Selected lssue Follow-up InspectionInspection ScopeAn inspection was performed at the Entergy corporate office in Jackson, Mississippi onJune 14 through 17 ,2010, to review the circumstances surrounding missed qualitycontrol (QC) verification inspections documented in CR-HQN-2009-01 184 andCR-HQN-2O10-00013. The issue involved QC verification inspections performed duringconstruction-related activities which were required as part of the Entergy qualityoversight and verification programs. The inspection was performed to determine if thelicensee had taken corrective actions commensurate with the significance of theidentified issues, and to assess the impact, if any, on the operability of plant equipmentcaused by the missed inspections. This inspection was conducted by inspectors fromRegions l, ll, and lV, as well as a Senior Program Engineer from the Quality and VendorBranch of the Office of Nuclear Reactor Regulation (NRR). The inspection covered allNRC-licensed sites owned by Entergy Operations, lnc., including Arkansas Nuclear One,James A. Fitzpatrick, Grand Gulf Nuclear Station, Indian Point Units 2and 3, PalisadesPlant, Pilgrim Nuclear Power Station, River Bend Station, Vermont Yankee, andWaterford 3.The inspectors reviewed root cause analyses documented in CR-HQN-2009-01 184 andCR-HQN-2010-00013, and the results of the licensee's extent of condition reviews andplant impact assessments. The inspectors also independently assessed the potentialimpacts of the missed inspections on the operability of plant equipment by reviewing allof the examples identified by the licensee, and by independently reviewing completedmodifications and work orders to identify additional examples. The inspectors alsoreviewed the corrective action database to assess reported equipment failures in orderto assess whether the failure might have involved missed QC verification inspections.The inspectors assessed causalfactors that may have contributed to missing QCverification inspections. This assessment included reviewing the Entergy Qualitya.Enclosure===
Specific data used by station personnel to reach this conclusion included the results of several core bores that were taken from concrete and reinforcing steel, visual observations of the dissimilar welds and carbon steel hardware, results of water samples taken during 2R19 showing very low levels of chlorides, and results of an EPRI study showing borated water does not aggressively attack carbon steel in the temperature range to which these components are exposed.The inspectors reviewed Entergy's evaluation and determined that Entergy personnel had adequately addressed the open item regarding the impact of the borated water on the liner attachment welds and carbon steel hardware.


b.37Assurance Program Manual(OAPM) requirements, changes made to the QAPM, andthe level of agreement between the QAPM and its implementing procedures.Specific documents reviewed are listed in the attachment.Findinqs and ObservationsThe inspectors identified problems with the implementation of elements of the QualityAssurance (QA) Program that affected the fleet of Entergy Operations Inc., (hereafterreferred to as "Entergy") nuclear power plants that are licensed by the NRC. While theplant organizations are NRC licensees, Entergy also has corporate groups which are notNRC licensees that are actively involved in some activities affecting sites, includingprogram and procedure changes. Entergy adopted a business strategy of adoptingstandard programs and procedures at allfleet plants.On October 30, 2009, the NRC discussed with Entergy personnel the initial concernsabout whether QC verification inspections were being performed consistently for thetypes of work that require that level of inspection. Both the non-licensed and licensedEntergy organizations responded with an appropriate review of the issues. Entergy'sreview of work documents that were potentially affected was extensive at each site.Entergy's total review examined over 320 Engineering Change documents and 2676work orders. Of the 30 work orders identified to have QC verification inspectiondeficiencies affecting eight safety-related design changes, all 30 were determined byEntergy personnel to have sufficient documentation to provide confidence that theequipment was installed correctly. Specific corrective actions were identified andimplemented to ensure that QC verification inspections would be included in current andfuture work documents, including procedure enhancements.The information provided to the NRC was used to perform a focused inspection in orderto assess the impact of the missed verification inspections at each of the NRC-licensedfacilities. The inspection documented below independently assessed the potentialimpact of missed QC verification inspections on the operability of plant equipment, aswell as assessing details of QA Program for the Entergy fleet.Two findings were identified during this inspection. These findings involved missed QCverification inspections at seven Entergy sites, and the assignment of individuals to theQA Manager position that did not meet the experience and qualification requirements ateight sites. Only the findings impacting lndian Point are described below.The inspectors concluded that the Entergy fleet organizational structure and Entergystrategy of adopting standardized procedures across the fleet were contributing factorsto the findings. Specifically:o Changes to adopt the standard fleet QA program created a partially conflict withexisting requirements for worker qualifications at some sites. The process forcreating and revising standardized fleet procedures and programs used to meet NRCrequirements must ensure that site-specific regulatory requirements andcommitments are properly addressed for all sites; and. Changes that removed details from existing site-specific QA and QC programimplementing procedures while shifting to standardized fleet procedures contributedto the finding involving missed QC verification inspections. Condition reports atEnclosure 38individual sites regarding problems related to this issue were not recognizedcollectively as symptoms of a problem with these procedures because they wereaddressed at the site level.(1) Failure to Perform Required Qualitv Control Inspectionslntroduction. The inspectors identified a Green NCV of 10 CFR 50, Appendix B,Criterion X, "lnspection," because Entergy personnel did not ensure that quality controlverification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for construction-like work activities asrequired by the QAP.Description. In response to the inspectors request for information concerningimplementation of the quality oversight and verification programs, the licenseeperformed a review of a representative sample of engineering changes and work ordertasks issued between 2006 and 2009. The licensee's review included performingequipment walkdowns, evaluating rework rates and human error rates, and causes forfailures of significant components. Based on the results of these reviews, Entergyinitiated CRs at the various sites to document problems with Quality Control (QC)verification activities and failures to perform required QC reviews of safety-relatedengineering changes and construction related work activities. Entergy's investigationconcluded that procedures contained inadequate guidance, which resulted ininconsistent implementation of the QC Program. Specifically, some safety-relateddesign change work orders were not reviewed to determine whether QC verificationinspections were required, and some safety-related design change work orders did notinclude all required QC verification inspections. These examples were documented inCR-HQN-2009-01083, -01084, -01085, -01093, -01096, -01140, -01169, -01170, -01184, and -01188.Additional findings identified by Entergy's review included:o Managers in maintenance organizations did not have a detailed understanding of QCresponsibilities, required inspections, or what documents required review (CR HON-2009-01 150);. A weakness was identified in the process for ensuring proper approval of contractQC inspection personnel at all Entergy sites. Procedure EN-QV-1 11, "Training andCertification of Inspection/verification and examination Personnel," Section 4.0 [1],required that the Manager responsible for Quality Assurance or designee at eachlocation is responsible for approving ANSI N45.2.6 certification of QC inspectionpersonnel. ln practice, contract QC inspectors'qualifications were not approved bythe QA Manager prior to November of 2009. This was determined to be a minorviolation because the ANSI Level lll inspector at each site was documenting that thecontract QC personnel had the necessary qualifications to perform the inspectionsfor which they were contracted. This issue was entered into the Entergy's CAP asCR-HQN-2009-1091;r At individual Entergy plants, 27 CRs were written in 2008 and 2009 to documentpotentially missed QC verification inspections or missed reviews to consider QCverification inspections prior to the NRC engaging Entergy on this issue. Of those,seven were actual missed inspections (CR-RBS-2009-05041, CR-JAF-2008-03648,and CR-PNP-2008-0091 6 and CR-PNP-2 008-03922, CR-PNP-2009-01798, CR-PNP-2009-02059, and CR-PN P-2009-02255). Multiple CRs documented workEnclosure 39paekage quality issues that impacted the ability to identify appropriate QC verificationinspection req uirements;r Two examples of QC programmatic issues were identified, assigned the Entergyheadquarters, and not properly addressed (CR-ANO-C-2009-01884, andCR-HQN-2009-00178). These were considered examples of the violation discussedbelow;r Although equipment-related QC CRs were addressed appropriately, QCprogrammatic issues were not always effectively addressed; and. QA audits and oversight activities for the QC Program missed opportunities toidentify the findings of their investigation (CR-HQN-2009-01169, CR-HQN-2009-0153, and CR-HQN-2010-00013). ln particular, the Entergy corporate ANSI Level lllinspector was required to perform periodic surveillances of QC inspection activities toensure the program is being adequately implemented and maintained, but theserequired surveillances were not performed in 2008 (CR-HON-2009-001 1 1). This isfurther discussed in Section 4OA7.Subsequent to the identification of these deficiencies, Entergy personnel initiatedcorrective actions to ensure that appropriate safety-related, engineering changes andnon-routine maintenance work orders were identified and routed to the Maintenancelnspection Coordinator for evaluation and inclusion of QC verification inspections inaccordance with the revised requirements of procedure EN-WM-105, "Planning." Thesecorrective actions and actions to preclude recurrence were collectively documented inthe following Level A CRs: CR-HQN 2009-01 184, dated December 21, 2009 and CR-HQN-2010-0013, dated January 6, 2010.In-office NRC reviews identified the need to conduct further inspection activities, OnJune 14 through 17 , 2Q10, the inspectors conducted a focused review of work performedat each NRC-licensed Entergy site to assess whether examples of missed QCverification inspections identified by Entergy during their review had the potential to haveimpacted the operability of important plant equipment. The inspectors also reviewed thecorrective action database and maintenance records to independently assess the rigorof the Entergy review and to identify additional examples of missed QC verificationinspections. The inspectors identified no additional examples, and concluded that theEntergy reviews were sufficient to identify the scope of the problems and developactions to address the causes.The inspectors' reviewed specific work items whose scope met QAPM requirements tohave had QC verification inspections but did not have the appropriate inspections.Based in part on interviews with Entergy personnel, the inspectors determined thatprocedural guidance for work planning was not sufficiently detailed or clear to ensurethat work packages with construction-like activities would be reviewed by the specifiedQC personnel. These individuals were responsible for designating the QC inspectionsthat were required by the QAPM.The inspectors also identified numerous CRs written at Entergy sites that documentedimproper implementation of QC verification inspections. Specific CRs are listed in theattachment.Analvsis. The performance deficiency associated with this finding was that Entergypersonnel did not ensure that ouality control verification inspections were consistentlyincluded and correctly specified in quality-affecting procedures and work instructions forEnclosure 40construction-like work activities as required by the QAP, This finding is more than minorbecause it's a programmatic deficiency that if left uncorrected, could lead to a moresignificant safety concern in that the failure to check quality attributes could involve anactual impact to plant equipment. This finding affected the design control attribute of theMitigating Systems cornerstone because missed quality control inspections during plantmodifications could impact the availability, reliability, and capability of systems needed torespond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," thefinding was determined to have very low safety significance (Green) because the findingis a qualification deficiency confirmed not to result in a loss of operability or functionality.Specifically, inspectors verified by sampling that work documents provided objectivequality evidence that work activities that had missed quality control verifications wereproperly performed.The finding has a cross-cutting aspect in the area of human performance associatedwith the decision-making attribute because the licensee did not have an effectivesystematic process for obtaining interdisciplinary reviews of proposed work instructionsto determine whether quality control verification inspections were appropriate. [H.1(a)per IMC 03101 (Section 4OA2.1.1)Enforcement. 10 CFR Part 50, Appendix B, Criterion X, "lnspection," requires, in part,that examinations, measurements, or tests of material... shall be performed for eachwork operation where necessary to assure quality . . . lf mandatory inspection holdpoints, which require witnessing or inspecting by the licensee's designatedrepresentative and beyond which work shall not proceed without the consent of thedesignated representative are required, the specific hold points shall be indicated inappropriate documents.Entergy's QAPM, Revision 20, Section B.12., "lnspection" requires, in part, that:"Provisions to ensure inspection planning is properly accomplished are to beestablished. Planning activities are to identify the characteristics and activities to beinspected, the inspection techniques, the acceptance criteria, and the organizationresponsible for performing the inspection. Provisions to identify inspection hold points,beyond which work is not to proceed without consent of the inspection organization, areto be defined."Contrary to the above, from February 2006 to December 2009, the licensee failed toensure that examinations, measurements, or tests of material were performed for eachwork operation where necessary to assure quality, and failed to include mandatoryinspection hold points in appropriate documents. Specifically, multiple examples ofMaintenance Work Orders and Engineering Change documents for construction-relatedactivities involving safety-related systems structures and components were identifiedwhere witnessing or inspections were required to be performed to ensure quality, butthese steps were not identified, included in the work documents, or performed asrequired QC hold points in the work instructions. Condition reports documenting thespecific problems and examples of the violation included:cR-lP2-2009-05321cR-1P2-2009-05399cR-HQN-2009-01085cR-tP2-2009-05348cR-tP3-2009-04883-cR-HQN-2009-01083cR-tP2-2009-05400cR-rP2-2009-05389cR-HQN-2009-01084Enclosure 41CR-HQN-2009-01093 CR-HQN-2009-01096CR-HQN-2009-01169 CR-HQN-2009-01170cR-HQN-2009-01 188*determined to be related to Unit 2CR-HQN-2009-01 140cR-HQN-2009-01 184Because this finding was of very low safety significance and was entered into Entergy'sCAP as CR-HQN 2009-01 184 and CR-HQN-2O10-0013, consistent with Section 2.3.2 oIthe Enforcement Policy, this violation is being treated as a NCV: NCV0500024712010005-04, Failure to Perform Required Quality Control Inspections.(2) Failure to lmplement the Experience and Qualification Requirements Associated Withthe Qualitv Assurange Prooramlntroduction. The inspectors identified a Green NCV of 10 CFR 50, Appendix B,Criterion ll, "Quality Assurance Program," because Entergy personnel did not implementthe qualification and experience requirements of the QAP to ensure that an individualassigned to the position of quality assurance manager (OAM) met the qualification andexperience requirements of ANSI/ANS 3.1-1978. Specifically, the individual assigned asthe responsible person for the Entergy's overall implementation of the QAP did not haveat least 1 year of nuclear plant experience in the overall implementation of the QAPwithin the quality assurance organization prior to assuming those responsibilities.Description. During their review of the issues surrounding the improper implementationof quality control (QC) verifications discussed above, the inspectors noted that the rootcause analysis documented in CR-HQN-2O10-0013 identified that lack of experience ofthe Quality Assurance (QA) Manager contributed to the failure to identify the trend inmissed QC verification inspections. The inspectors reviewed the relevant experienceand qualifications of the QA Manager at each Entergy site. The inspectors alsoreviewed the NRC's safety evaluation report that approved Entergy's original corporateQuality Assurance Program Manual (QAPM), which is the document that contains theQA Program, Additionally, the inspectors reviewed the administrative section of theTechnical Specifications for all the Entergy sites and a sample of evaluations, performedin accordance with 10 CFR 50.sa(a), that supported Entergy QAPM changes andalignment of plants that.were subsequently purchased by Entergy.The Entergy corporate QAPM required each site to meet the experience andqualification standards in ANSI/ANS 3.1-1978, "American National Standard forSelection and Training of Nuclear Power Plant Personnel." Section 4.4 includedqualification and experience requirements for the personnel described as "groupleaders" of five professional{echnical groups, including Quality Assurance. Section4.4.5, "Quality Assurance," required that ". ..the responsible person shall have six yearsexperience in the field of quality assurance, preferably at an operating nuclear plant, oroperations supervisory experience. At least one year of this six years experience shallbe nuclear power plant experience in the overall implementation of the quality assuranceprogram. (This experience shall be obtained within the quality assurance organization.)"On December 15, 2008, procedure EN-QV-1 17, "Oversight Training Program," theEntergy procedure used by all Entergy sites to implement the requirements of ANSI/ANS3.1-1978, was revised by the Entergy corporate QA group. Section 5.7, "Manager/QASenior Auditor Training," was changed to state:Enclosure 42Either the QA Manager or the Senior QA Auditor will meet the requirements ofANS 3.1-1978 paragraph 4.4.5'for operating plants and if applicable ANS 3.1-1993 paragraph 4.3.7 for new plants.The inspectors reviewed completed Personnel Change Planning ChecklisUForms for QAManagers at each site. Entergy used this form to evaluate QA manager candidates priorto the implementation of an Entergy fleet-wide restructuring in July 2007. Attachment 8,"Change Management Guidelines for Alignment lmplementation," included the followingconclusion for the individual that subsequently was assigned to be the QA Manager:Individual's name redacted] meets the minimum requirements for QA Managerwith the exception of at least one year of this six years experience shall benuclear power plant experience in the overall implementation of the qualityassurance program. This requirement must be met by the QA Senior Auditor.Based on discussions with Entergy corporate QA personnel, the inspectors determinedthat Entergy personnel had interpreted ANSI/ANS 3. 1-1978, Sections 4.4 and 4.4.5 toallow the Senior Auditor to be considered the QA group leader described in the standardfor purposes of meeting the experience reguirements of Section 4.4.5 in cases where acandidate for the position of QA Manager did not satisfy the experience requirements.In reviewing this issue, the NRC staff has determined that the group leader in this caseis the individual filling the position assigned responsibility for overall implementation ofthe QA Program (Entergy used the title "QA Manager" for this position). The individualmeeting the experience and qualification requirements must be the individual assignedthe responsibilities for overall implementation of the QA Program assigned within the QAProgram.The inspectors determined that this change to procedure EN-QV-117 did not ensure thatthe qualifications for the QA Manager would meet the requirements of standard. Theinspectors identified an example where the Senior Auditor was credited as being thegroup leader for purposes of meeting ANSI/ANS 3.1-1978, and the individual who wasassigned as the QA Manager did not meet the ANSI/ANS 3.1-1978 experiencerequirements. The team also determined that the responsibilities assigned to the QAManager under the QAPM were not reassigned to the Senior Auditor, and the SeniorAuditor did not report directly to the designated senior executive. The Senior Auditorcontinued to report to the QA Manager, so the person with the greater experience didnot have the positional authority to decide issues.Analvsis. The performance deficiency associated with this finding was that Entergy didnot implement the qualification and experience requirements of the QAP to ensure thatan individual assigned to the position of QAM met the qualification and experiencerequirements of ANSI/ANS 3.1-1978. This finding is more than minor because if leftuncorrected, it could lead a more significant safety concern. Specifically, the failure tohave a fully qualified individual providing overall oversight to the QAP had the potentialto affect all cornerstones. However, this finding will be tracked under the MitigatingSystems cornerstone as the area most likely to be impacted.The finding was not suitable for quantitative assessment using existing SignificanceDetermination Process guidance. Using IMC 0609, Appendix M, "SignificanceDetermination Process Using Qualitative Criteria," NRC management determined theEnclosure 43finding to be of very low safety significance (Green) because other quality assuranceprogram functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist.The inspectors determined that there was no cross-cutting aspect associated with thisfinding because the performance deficiency did not reflect Entergy' current performance.Specifically, the performance deficiency occurred more than three years ago and wasoutside the current assessment period.Enforcement. 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program,"requires, in part, that the licensee establish a quality assurance program which complieswith Appendix B. This program shall be documented by written policies, procedures, orinstructions and shall be carried out throughout plant life in accordance with thosepolicies, procedures, or instructions. The program shall provide for indoctrination andtraining of personnel performing activities affecting quality as necessary to assure thatsuitable proficiency is achieved and maintained.The Entergy Quality Assurance Program Manual, Revision 13, is the document used ateach Entergy-owned site to describe the quality assurance program. Table 1, Section Aof the Quality Assurance Program Manual states, in part, that qualifications andexperience for station personnel shall meet ANSI/ANS 3.1-1978 except for positionswhere an exception to either ANSI/ANS 3.1-1978 or N18.1-1971 is stated in theapplicable unit's Technical Specifications.ANSI/ANS 3.1-1978, Section 4.4.5, "Quality Assurance," states, in part, that theresponsible person (i.e. the Quality Assurance Manager) shall have six years experiencein the field of quality assurance. At least one year of this six years experience shall beobtained within the quality assurance organization.Contrary to the above, between July 7,20Q7 and July 8, 2008, the licensee failed toimplement the quality assurance program requirements intended to provideindoctrination and training of personnel performing activities affecting quality asnecessary to assure that suitable proficiency was achieved and maintained. Specifically,the individual assigned to be the responsible person for the licensee's overallimplementation of the Quality Assurance Program did not have at least 1 year of nuclearplant experience in the overall implementation of the Quality Assurance Program withinthe quality assurance organization prior to assuming those responsibilities. Because thisfinding was of very low safety significance and was entered into Entergy's CAP as CR-HQN-2010-00386, consistent with Section 2.3.2 of the Enforcement Policy, this violationis being treated as a NCV: NCV 0500024712010005-05, Failure to lmplement theExperience and Qualification Requirements of the Quality Assurance Program.Enclosure 40A344Event Follow-Up (71153 - 3 samples)(Closed) Licensee Event Report 05000247/2010-007-00, Automatic Reactor Trip Dueto a Turbine Trip as a Result of a Hiqh Steam Generator Level Trip After Transition toSinqle Feedwater Pump OperationInspection ScopeOn September 3, 2010, during a scheduled plant shutdown, an automatic reactor tripoccurred at approxim ately 41%o power as a result of a turbine trip due to a high steamgenerator (SG) water level. The inspectors evaluated the response of control roompersonnel and plant equipment following the automatic reactor trip as described in NRClnspection Report 0500024712010004. Entergy personnel determined that the rootcause of the eventwas inadequate design controlof the proportional band and resettuning settings for critical plant controllers; and that there was less than optimum settingson the MBFP speed controller, feed regulatory valve flow controllers, and the SG levelcontrollers for low power operations. The immediate corrective actions includedchanging the MBFP speed controller settings to the optimum settings. Entergypersonnel documented the root cause evaluation in CR 1P2-2010-05484. This LER isclosed.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one event follow-up sample as defined in NRCInspection Procedure 7 1 153.Findinqslntroduction. A Green self-revealing finding was identified because Entergy's procedure2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control," didnot provide adequate guidance to ensure proper settings for the MBFP speed controllersettings at low power operations, contributing to a reactor trip from 41o/o power during aplanned shutdown on September 3, 2010.Description. On September 3, 201A, during a planned shutdown to repair the 21 reactorcoolant pump, an automatic reactor trip occurred as a result of a turbine trip due to ahigh steam generator (SG) water level. Prior to the event, operations personnel hadreduced reactor power from 100% to 41o/o with both MBFPs in operation. Operatorsremoved the 21 MBFP from service as planned, and the 22 MBFP increased in speed tomake up for the 21 MBFP being removed from service. However,22 MBFP was slow toincrease in speed, resulting in a decrease in water levelto allfour SGs. The 22MBPFcontinued to increase in speed and flow even when SG level began to recover, causingan increase in SG water level. Due to the increasing SG water level, operators tookmanual control of the 24feed regulation valve (FRV) to reduce feedwater flow. The 22and 23 FRVs automatically responded by reducing flow to the 22 and 23 SGs.Operations personnel also took manual control of the 21 FRV to reduce flow to hhe 21SG. The decrease in flow to the 21 and 24 SGs resulted in an increase in feedwaterflow to the 22 and 23 SGs, until the high level trip setpoint was reached in the 23 SG,and a turbine trip and reactor trip was automatically initiated per the plant design.Entergy personnel performed a root cause evaluation (CR-lP2-2010-5484), anddetermined the root cause was inadequate design control of the proportional band and,1Enclosure 45reset tuning settings for critical plant controllers. Entergy personnel determine therewere less than optimum controller settings on the MBFP speed controller, feedregulatory valve flow controllers, and steam generator level controllers for low poweroperations. Entergy personneltook immediate corrective actions to change the MBFPspeed controller settings. Entergy's corrective actions included reviewing l&Cprocedures to ensure that the instrument calibration requirements matched l&Cpreventative maintenance documents, and a list of critical controllers was generated andthe Equipment Data Base (EDB) updated with known controller settings. Entergy'splanned corrective actions include reviewing l&C procedures to identify changes toensure controller calibrations maintain required settings, reviewing procedures toincorporate testing of critical parameters, and issuing an engineering evaluation andupdating the EDB in the work control program with findings on controller settings.The inspectors reviewed a design change on May 5,2Q06, where Entergy staffprocessed a change to remove the settings for the MBFP speed controllers from l&CProcedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure SpeedControl." As a result, the MBFP speed controller settings were not maintained at theproper settings. The inspectors determined the change was processed through DRN-06-02146 inappropriately as an editorial change and not a technical change and thus didnot receive a cross-disciplinary review and user validation required by procedure lP-SMM-AD-102, "IPEC lmplementing Procedure Preparation, Review, and Approval." Thespeed controller settings caused a slower response of the 22MBFP after the 21 MBFPwas removed from service. The inspectors determined that without prescribed MBFPspeed controller settings, that l&C procedure 2-lC-PC-N-P-408A, "Main Boiler FeedPump Discharge Pressure Speed Control," was not adequate to ensure proper operationof the MBFPS.Analvsis. The performance deficiency associated with this finding was that Entergy'sprocedure 2-lC-PC-N-P-408A did not provide adequate guidance to ensure propersettings for the MBFP speed controller settings at low power operations. This finding ismore than minor because it is associated with the design control attribute of the InitiatingEvents cornerstone and affects the cornerstone objective of limiting the likelihood ofthose events that upset plant stability and challenge critical safety functions duringpower operations. Specifically, inadequate design control of the MBFP speed controllersettings contributed to a reactor trip.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," thefinding was determined to have very low safety significance (Green) because the findingdid not contribute to the likelihood that mitigation equipment or functions would not beavailable,The inspectors determined there was no cross-cutting issue associated with the findingbecause the performance deficiency did not reflect current licensee performance.Specifically, the performance deficiency occurred several years ago and was outside thecurrent assessment period.Enforcement. This finding does not involve enforcement action because no regulatoryrequirement violation was identified. Because this finding does not involve a violation,has very low safety significance, and it was entered into Entergy's CAP as CR 1P2-2010'05484, it is identified as a finding: FIN 500024712010005-06, Inadequate Main BoilerFeed Pump Speed Gontroller Setting.Enclosure 46.2Automatic Reactor Trip on Turbine Trip Due to 21 Main Transformer Failurelnspection ScopeThe inspectors reviewed the below listed event for plant status and mitigating actions toevaluate Entergy performance and confirm that Entergy operators implemented actionsand notifications (if required) in accordance with station procedures. The inspectors alsoreviewed Entergy's emergency response actions to evaluate Entergy staff performanceand confirm that Entergy staff implemented actions and notifications in accordance withstation procedures for the Alert declaration.At 1839 hours on November 7, 2010, Unit 2 experienced a reactor trip. At 1841 , the Unit2 control room operators were informed that that there had been an explosion in the Unit2 transformer yard/diesel generator building area. The station fire brigade was activatedto respond to the notification of explosion. Soon thereafter, a second explosionoccurred, and this one was felt and heard in the Unit 2 control room. At 1849, the Unit 2Shift Manager declared an Alert emergency based on reports of two explosions in thetransformer yard (Entergy subsequently determined that both explosions were the resultof the 21 main transformer failure). The Alert declaration was made in accordance withemergency action level (EAL) 8.2.3, which states "fire or explosion in any plant area,Table 8.1, which causes or potentially causes any required safety related system orstructure to become inoperable." The diesel generator building/fuel tank area is listed inTable 8.1. The operation's crew activated the IPEC emergency response organization(ERO) to respond to the event. Entergy staff terminated the emergency at 2218 hours.The inspectors evaluated the response of control room personnel following theautomatic reactor trip that occurred as a result of the failure of 21 main transformer. Theinspectors reviewed plant computer data, including the sequence of events report,evaluated plant parameter traces, and discussed the event with plant personnel, to verifythat plant equipment responded as expected, and to ensure that operating procedureswere appropriately implemented. The inspectors also verified that Entergy's post tripreview group (PTRG) identified the most probable cause(s) of the trip to facilitatecorrective actions prior to restart. This event and the PTRG report were entered intoEntergy's CAP as CR-lP2-201 0-0680't.The inspectors also reviewed Entergy actions and decision making to verify decisionswere consistent with a conservative approach to assessing the condition and inaccordance with the site emergency plan. The inspectors reviewed logs and recordsfrom the night of the event, interviewed operational and emergency planning staff, andreviewed Alert Report and other corrective action documentation.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one event follow-up sample as defined in InspectionProcedure 71153.FindinqsNo findings were identified associated with the operational response to the reactor trip.b.Enclosure 47There were two findings identified regarding Entergy staff's implementation of theemergency plan. The inspectors will conduct further review of the root cause evaluation(RCE) and associated corrective actions in conjunction with review of the licensee eventreport to be submitted by Entergy personnel.(1) Failure to Staff the TSC and OSC within the Required Time LimitIntroduction. A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses,"paragraph (q) was identified because Entergy staff did not adequately implement therequirements of the IPEC Emergency Plan.Description. On the evening of November 7,2010, the Unit 2 operating crew declaredan Alert emergency at 1849 hours. At 1852 hours, the crew activated the DialogicSystem, which notifies the site ERO of the event and requires the augmentation of theon-shift ERO by the on-call responders. The IPEC Emergency Plan, Section H,Emergency Facilities and Equipment, requires that the TSC and OSC be operationalwithin 60 minutes after a declaration of an Alert, Site Area Emergency, or GeneralEmergency. The TSC was staffed and declared operational at 2008 hours, and the OSCwas staffed and declared operational at 2015 hours. Both of these activation timesexceeded the 60 minute staffing requirement in the IPEC Emergency Plan.Entergy determined that two factors contributed to the failure to staff the emergencyresponse facilities in the required time. First, there were notified ERO members whoquestioned the validity of the beeper indications or believed that other ERO memberswould respond, and therefore did not respond to their assigned emergency responsefacility. Entergy determined this behavior was not in accordance with the IPEC EROaugmentation design and training nor consistent with station expectations. Second,during the event, problems occurred with the beeper and phone systems used for EROcall-in. Some of the ERO responders indicated that the system recording stated therewas no emergency, while other personnel received a beep but were unable to call in.The failure to comply with the requirements of the IPEC Emergency Plan resulted inEntergy's failure to comply with NRC regulations for timely augmentation of emergencyresponse capabilities.Entergy personnel documented the station's performance during the Alert emergency inan event report, and initiated several condition reports to address deficiencies inequipment and personnel performance. CR-lP2-2010-06870 was written to investigateand correct the condition that the TSC and OSC did not meet minimum required staffingwithin the required 60 minutes. CR-lP2-2010-6813 and CR-IP2-2010-6831 wereinitiated to address the reported technical problems with the beeper and phone system,while CR-lP2-2010-6871 was written to address why certain individuals on the on-callERO team did not report to the site or were late.The inspectors reviewed the event report and the CRs to assess the adequacy ofEntergy's self-assessment and of the planned corrective actions. The inspectorsdetermined that Entergy had identified the causes of the November 7 staffing issues andconcluded that actions taken and planned corrective actions were adequate.Analvsis. The performance deficiency associated with this finding was that Entergypersonnel did not meet the requirements of the IPEC Emergency Plan in that the TSCand OSC were not staffed nor declared operational within 60 minutes of the AlertEnclosure 48emergency declaration on November 7,2010. This finding is more than minor becauseit affected the Emergency Response Organization attribute of the EP Cornerstone toensure that the licensee is capable of implementing adequate measures to protect thepublic health and safety in the event of a radiological emergency.In accordance with IMC 0609, Appendix B, "Emergency Preparedness SignificanceDetermination Process," the inspectors determined the finding to be of very low safetysignificance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section4.2 and Sheet 2, "Actual Event lmplementation Problem," and determined that the failureto comply with an aspect of the Emergency Plan related to ERO augmentation (10 CFR50.47(b)(2)) was a non-risk-significant planning standard problem which occurred duringan Alert emergency and is therefore a Green finding.This finding has a cross-cutting aspect in the area of human performance associatedwith the work practices attribute of defining and effectively communicating expectationsregarding procedural compliance and personnel following procedures. Specifically,Entergy staff did not comply with ERO expectations and procedures regarding promptreporting to an assigned emergency response facility during an actual event. [H.a(b) perrMc 03101Enforcement. 10 CFR 50.54(q) requires, in part, that a licensee "shallfollow andmaintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) andthe requirements in Appendix E of this part." 10 CFR 50.47(bX2) requires, in part, that"timely augmentation of response capabilities is available."Contrary to the above, on November 7, 2010, the IPEC ERO did not respond and staffthe site TSC and OSC in a timely manner. The IPEC Emergency Plan requires thatthese facilities be staffed and operational within 60 minutes of an Alert emergencydeclaration. On November 7, the TSC was declared operational 79 minutes after theAlert declaration, and the OSC 86 minutes after the declaration. By failing to meet therequirements of the IPEC Emergency Plan, and therefore 10 CFR 50.47(b)(2), Entergywas in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of theIPEC Emergency Plan. Entergy initiated training and counseling corrective actions toaddress the personnel performance issues and equipment issues. Because this findingis of very low safety significance and was entered into Entergy's CAP as CR- lP2-2010-6813, -6831, and -6870, consistent with Section 2.3.2 of the NRC Enforcement Policy,this violation is being treated as a NCV: NCV 00500024712010005-07, Failure to Staffthe Site TSC and OSC within 60 Minutes of an Alert Emergency Declaration.(2) Failure of Offsite Notification Procedure to Meet the Requirements of the SiteEmerqencv PlanIntroduction. The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions ofLicenses," paragraph (q) because the Entergy EPIP for notification of offsite officials didnot meet the requirements of the IPEC Emergency Plan.Description. Following the declaration of the Alert emergency at 1849 hours onNovember 7, 2010, the central control room (CCR) crew entered EPIP IP-EP-210,"Central Control Room." Attachment 9.1, Shift Manager/POM (Emergency Director)Checklist, of the EPIP directs the Shift Manager to complete a NYS RadiologicalEmergency Data Form, Part 1 (Form EP-1), and then have the CCR OffsiteEnclosure 49Communicator email and fax the form to offsite authorities. Using the radiologicalemergency communication system (RECS) and Form EP-4, the Offsite Communicatorconfirms receipt of the Part 1 Form by offsite authorities. A note in Attachment 9.1requires that notification of state and local authorities shall be initiated within 15 minutesof an Alert declaration. The IPEC Emergency Plan, Section E, Notification Methods andProcedures, paragraph 1.b.5, requires in part that an immediate notification (within 15minutes) of an Alert is made by the Shift Manager or his designee to the New York Stateand Westchester, Rockland, Putnam, and Orange Counties. NRC regulations,specifically 10 CFR 50.47(bX5), require in part that "procedures have been establishedfor notification, by the licensee, of State and local response organizations."On the evening of November 7, when the Offsite Communicator attempted, via atelephone conference line, to confirm receipt of the Part 1 Form, the communicatorlearned that a problem had occurred with the fax machine and the only offsite authorityto have received the fax was New York State. Per the direction of the guidance in FormEP-4, the Offsite Communicator instructed the four county personnel on the telephoneconference to obtain the Form 1 from the State. One of the county personnel requestedthe Offsite Communicator to read the Form 1 over the conference line. The OffsiteCommunicator complied with the request and read the Form 1 information to the fourcounty personnel at approximately 1902 hours, within 15 minutes of 1849 hours.On November 8, 2010, in response to Entergy's event notification to the NRC, theRegion I senior emergency preparedness inspector discussed the November 7 eventwith the IPEC Emergency Planning Manager. The inspector questioned that Form EP-4provided for the delegation of Entergy's responsibility for notification, an apparentcontradiction of Emergency Plan requirements. Due to County staff intervention, theoffsite notifications were adequately performed, but the NRC inspector identified that hadthe Offsite Communicator followed his procedural guidance, the notifications would nothave been made in accordance with IPEC Emergency Plan requirements or with NRCregulations. The inspector determined that Form EP-4 had provided for the deficientbackup method since it was revised in July 2006. Entergy initiated in CR-lP2-2010-07563 to investigate and resolve Form EP-4 deficiency concerning the backup methodfor offsite notification.Entergy personnel determined the problem encountered with the fax machine on theevening of November 7,2010, was due to a design flaw in the MIDAS software packageused to construct the Form 1. The flaw involved a feature that would prevent sendingthe Form 1 file if the user attempts to send the file before a data compiling feature of theprogram has completed its function. Entergy personnel concluded that on November 7,the Offsite Communicator had attempted to send the form too soon after data had beenentered. The problems encountered with MIDAS were replicated after the event, andEntergy initiated software design changes to the MIDAS program to correct the timingdeficiency.The NRC reviewed the IPEC Emergency Plan and its associated EPlPs, reviewedrecords from the November 7,2010, event, and discussed the issue with IPEC andCounty personnel. Further, the inspector reviewed the planned changes to Form EP-4and the intended design changes to the MIDAS and fax software. The inspectorconcluded the planned corrective actions appeared adequate to correct the problemsidentified as a result of the November 7,2010 event.Enclosure
Further, with respect to the b.Enclosure 34 structural integrity of the reactor cavity liner and concrete, the inspectors reviewed:
1)core samples that were taken from reactor cavity concrete structure; 2) photographs of additional core samples and imbedded rebar; and 3) the licensee and vendor evaluations including petro graphic examination of the concrete aggregate.


===.350 Analvsis. The performance deficiency associated with this finding was that Entergyprocedures allowed for a back-up notification process that did not comply with therequirements of the site emergency plan: the emergency plan requires that the ShiftManager or his designee notify the offsite authorities of an emergency declaration, whileForm EP-4 directed the delegation of this responsibility to an offsite authority itself. Thisfinding is more than minor because it affected the Emergency Response Organizationattribute of the EP cornerstone to ensure that the licensee is capable of implementingadequate measures to protect the public health and safety in the event of a radiologicalemergency.In accordance with IMC 0609, Appendix B, "Emergency Preparedness SignificanceDetermination Process," the inspectors determined the finding to be of very low safetysignificance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section4.5 and Sheet 1, "Failure to Comply," and determined that the failure to comply with anaspect of the Emergency Plan related to event notification (10 CFR 50.47(bX5)) was arisk-significant planning standard (RSPS) problem. lt was not a RSPS functionalfailureof the IPEC event notification process, because the deficiency in the IPEC EPIP was inthe backup method for offsite notification, and despite the procedural flaw offsitenotifications were made in a timely and accurate manner on November 7,2Q10.The inspectors determined there was no cross-cutting issue associated with the findingbecause the performance deficiency did not reflect current licensee performance.Specifically, the performance deficiency occurred greater than three years ago and wasoutside the current assessment period.Enforcement. 10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part,that a licensee "shall follow and maintain in effect emergency plans which meet thestandards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR50.47(bX5) requires, in part, that "procedures have been established for notification, bythe licensee, of State and local response organizations."Contrary to the above, since July 2006 Entergy IPEC EPIPs provided a backupnotification method that delegated the licensee's responsibility for offsite notifications toan offsite authority. The IPEC Emergency Plan and 10 CFR 50.47(bX5) require that theEntergy IPEC staff perform the notification of offsite authorities. Due to this proceduredeficiency, Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining theconditions of the IPEC Emergency Plan. Entergy initiated corrective actions to correctForm EP-4 by having the Offsite Communicator read the Part 1 Form to the offsiteauthorities if the faxlemail method does not work. Because this finding is of very lowsafety significance and was entered into Entergy's CAP as CR-lP2-2010-07563,consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is beingtreated as a NCV: NCV 005000247 and 005000286/2010005-08, Failure of OffsiteNotification Procedure to Meet the Requirements of the Site Emergency Plan.Loaded Multi-Purpose Canister Stuck Durinq Transfer from the HI-TRAC Transfer Caskto a HI-STORM Storaqe CaskInspection ScopeThe inspectors reviewed the below listed equipment problem for plant status andmitigating actions to evaluate Entergy personnel performance and confirm that thea.Enclosure===
The inspectors also reviewed completed License Renewal actions as accepted by the NRC Staff's SER for various letters submitted by Entergy up to and including June 2009.Specifically, the following items for 2010 were reviewed and evaluated:
1) three core samples of concrete from the observed leakage location to determine the compressive strength of the concrete and pH value as well as boron and chloride concentration in concrete and water; and 2) visual examination of the exposed reinforcements.


b.51Entergy staff implemented actions and notifications in accordance with stationprocedures.From July through November 2010, Entergy personnel conducted a campaign to placeselected spent fuel elements into dry cask storage. On November 18, 2010, during thestack up and transfer of a fully loaded Multipurpose Canister (MPC) MPC-32 canisterfrom the HI-TRAC transfer cask into a HI-STORM storage cask, the MPC becamelodged while partially inserted into the mating device. The MPC had been loweredapproximately 8 inches into the mating device from the HI-TRAC, but became lodgedand could not be lowered or raised with the fuel storage building (FSB) gantry crane.Through consultation with representatives of Holtec International (Holtec), the storagesystem vendor; and Ederer, the Unit 2 FSB gantry crane manufacturer; Entergypersonnel determined the problem to be a result of a misalignment of the HI-TRAC andthe mating device that joins the HI-TRAC to the HI-STORM for the MPC transfer. Afternot being able to dislodge the MPC during the stack up and transfer on November '18,2010, Entergy personnel, in consultation with Ederer personnel on site, bypassed thecrane load cell so that the 90,000 pound limit could be exceeded. The FSB gantry craneauxiliary hoist was slowly and incrementally raised. At approximately 100,000 poundsthe MPC was successfully dislodged, the load cell dropped down to approximately87,000 pounds, and the MPC was able to be raised back into the HI-TRAC. TheHI-TRAC and MPC were then lifted off the HI-STORM and mating device and placedinto a safe storage position on November 19, 2010. Entergy personnel subsequentlyresumed dry cask operation stack up and transfer on December 13, 2010 and the MPCwas able to be loaded into the HI-STORM that day. The HI-STORM was subsequentlyplaced on the independent spent fuel storage installation (lSFSl) pad on December 16,2010, and no additional problems were encountered.The inspectors reviewed Entergy actions and decision making to verify decisions wereconsistent with a conservative approach to assessing and addressing the condition. Theinspectors reviewed whether Entergy evaluations (and/or vendor suppliedcorrespondence) were supported and addressed the structural performance of the MPC.The inspectors also reviewed station evaluations that concluded there was no structuraldamage to the mating device. The inspectors determined that Entergy and vendor-supplied evaluations appropriately concluded that the MPC was not adversely impactedin either thermal or structural performance. Entergy entered the issue into the CAP andplans to revise Holtec procedure 2-DCS-009-GEN, "MPC Transfer & HI-STORMMovement," to ensure that the HI-TRAC is properly aligned with the mating devicebefore the next cask is loaded.Specific documents reviewed during this inspection are listed in the attachment. Theseactivities constitute completion of one event follow-up sample as defined in NRCInspection Procedure 7 1 1 53.FindinqsNo findings were identified.Enclosure 524OA5 Other Activities.1 Confirmatorv Order. EA-09-060. November 10. 2009. Failure to Provide Complete andAccurate lnformationInspection ScopeOn May 22, 2008, the NRC completed a security baseline inspection at the PalisadesNuclear Plant. The inspection covered one or more of the key attributes of the securitycornerstone of the NRC's Reactor Oversight Process. As a result of the inspectionobservations, the NRC Office of Investigations (Ol) initiated an investigation (Ol CaseNo. 3-2008-020). Based on the evidence developed during the inspection andinvestigation, the NRC identified a violation of 10 CFR 50.9 for inaccurate andincomplete information. Specifically, the licensee failed to ensure that information incorrective action documents was complete and accurate in all material respects andfailed to provide accurate information to the Commission during a telephoneconversation between a licensee employee and an NRC inspector.The results of the investigation were sent to Entergy in a letter dated July 14,2009. Thisletter offered Entergy the opportunity to either participate in Alternate Dispute Resolution(ADR) mediation or to attend a Predecisional Enforcement Conference. On July 28,2009, the NRC and Entergy agreed to participate in ADR mediation.On September 15, 2009, the NRC and Entergy participated in an ADR session and, as aresult, a Confirmatory Order was issued pursuant to the agreement reached during theADR process. As part of the ADR settlement agreement, Entergy agreed to a number oforganizational, procedural, and management oversight related corrective actions andenhancements at Palisades Nuclear Plant and other Entergy Fleet nuclear sites.During this inspection at Indian Point Energy Center, from November 15 - 19, 2010, theinspectors evaluated the overall effectiveness of the licensee's response to Action ltem 2of the Confirmatory Order. Specifically, Entergy developed and implemented a formalprocess, within the current CAP, that ensured that Safeguards and Security-Relatedinformation, which would othenrvise not be contained in the CAP, is processed in anauditable manner, consistent with Entergy's existing CAP.The evaluation was conducted through: 1) interviews with non-supervisory personnel atIndian Point Energy Center; 2) interviews with program managers and supervisorsresponsible for implementing the CAP at the site; and 3) an evaluation of licenseedocuments and procedures related to compliance with Action ltem 2 of the ConfirmatoryOrder.The inspectors conducted the following specific inspection activities to:. Verify CRs that require documentation of Safeguards Information (SGl) were clearlyidentified as Safeguards CRs;o Verify where SGI is required to describe the condition or corrective actions, theadditional information is contained in a uniquely identified and referenced safeguardsdocument:Enclosure b.a..253r Verify that CRs that require documentation of SGI reference the uniquely identifiedsafeguards document and the uniquely identified safeguards document referencesthe CR;. Verify the site security manager identified situations where SGI may need to bediscussed for the Condition Review Group (CRG) and Corrective Action ReviewBoard (CARB)to properly prioritize CRs or review CR evaluations, and thatmembers of the CRG and CARB were qualified to review SGI;. Verify that review of the adequacy of the response to a corrective action wasperformed by safeguards qualified personnelwhen SGI was required to describeinformation in the Corrective Action (CA); and. Verify that closure reviews for safeguards CRs were performed by safeguardsqualified personnel.FindinqsNo findings were identified.Independent Spent Fuel Storaqe Installation Monitorinq Controls (60855)Inspection ScopeThe inspector reviewed routine operations and monitoring of the lSFSl. The inspectorwalked down the lSFSl, observed the condition of the storage modules including the aircooling ventilation openings, performed independent dose rate measurements of thestorage modules, and reviewed logs that confirmed daily walkdowns were performed toobserve ventilation openings for the months of August through November 2010 asspecified in NRC Certificate of Compliance no. 1014 requirements.FindinqsNo findings were identified.Review of the Shift Staffino RequirementsInspection Scopelnspectors reviewed the circumstances surrounding the February 9, 2010 occurrencewhere the Control Room Supervisor (CRS), assigned as having the control roorncommand function, left the control room without designating another senior reactoroperator qualified individual to assume the control room command function.FindinqsCommand Function SLO Leaves the Control Roomlntroduction. A Green self-revealing NCV of TS 5.1, "Responsibility," was identifiedbecause on February 9,2010, the CRS assigned as having the control room commandfunction, left the control room without designating another SRO-qualified individual toassume the control room command function.b..3Enclosure 54Description. On February 9,2010, the CRS, one of two SRO-qualified individuals in thewatch section, left the control room to lead the morning meeting. The Shift Supervisor(SS) was already out of the control room and the CRS had the responsibility for thecontrol room command function at that time. This left the reactor operators with nosenior reactor operator in the control room to respond to events.The Reactor Operator (RO) promptly recognized that there was no SRO in the controlroom and initiated actions to have the CRS return to the control. Upon hearing the ROpaging him, the CRS realized his mistake and returned to the control room. The CRSwas out of the control room for approximately 5 minutes. Technical Specification 5.1,"Responsibility," states that the SS shall be responsible for the control room commandfunction and that during any absence of the SS from the control room while the unit is inMODE 1, 2,3, ot 4, an individual with an active Senior Reactor Operator (SRO) licenseshall be designated to assume the control room command function. Entergy entered thisissue into the CAP as CR-lP2-2010-00708.Analvsis. The performance deficiency associated with this finding was that the CRS leftthe control room without designating an SRO-qualified individual to assume the controlroom command function, contrary to the requirements of TS 5.1. His actions were alsocontrary to requirements of Entergy Nuclear Management Manual Procedure EN-OP-1 15, "Conduct of Operations." This finding is more than minor because it couldreasonably be viewed as a precursor to a significant event. Specifically, the absence ofSRO oversight during licensed control room activities increases the likelihood of humanperformance errors contributing to an initiating event and reduces the effectiveness ofevent mitigation. The finding is associated with the human performance attribute of theMitigating Systems cornerstone and affects the cornerstone objective of ensuring theavailability, reliability and capability of systems that respond to initiating events toprevent undesirable consequences.The finding was not suitable for quantitative assessment using existing SignificanceDetermination Process guidance. Using IMC 0609, Appendix M, "SignificanceDetermination Process Using Qualitative Criteria," NRC management determined thefinding to be of very low safety significance (Green) because of the short period the CRSwas absent from the control room, and because no initiating events occurred during thattime.The finding has a cross-cutting aspect in the area of human performance associatedwith the work practices attribute because of the ineffective use of shift turnover practices,in that the CRS did not self check or communicate his decision to leave the control roomto the rest of the control room staff. [H.a(a) per IMC 0310]Enforcement. Technical Specification 5.1, "Responsibility," states that the SS shall beresponsible for the control room command function and that during any absence of theSS from the control room while the unit is in MODE 1, 2,3, or 4, an individual with anactive Senior Reactor Operator (SRO) license shall be designated to assume the controlroom command function.Contrary to the above, on February 9,2010, while the unit was in MODE 1, the Unit 2CRS left the control room for a period of approximately five minutes without designatingan individualwith an active SRO license to assume the control room command function.Because this TS noncompliance is of very low safety significance (Green) and wasEnclosure 55entered into the CAP as CR-lP2-2010-00708, consistent with Section 2.3.2 of the NRCEnforcement Policy, this violation is being treated as an NCV: NCV 0500024712010005-09, Failure to Meet TS Oversight Requirement.4OAO Meetinqs. Includinq ExitOn December 2,2Q10, the inspector presented inspection results of the radiation safetybaseline inspection to Mr. Donald Mayer and other members of Entergy staff. Theinspector asked the licensee whether any materials examined during the inspectionshould be considered proprietary. No proprietary information was identified.On December 9, 2010, the inspector presented the inspection results of the licensedoperator requalification to members of licensee management. The licenseeacknowledged the issues presented. The inspector asked the licensee whether anymaterials examined during the inspection should be considered proprietary. Noproprietary information was identified.On January 10,2011, the inspector presented the results of the Selected lssue Follow-up Inspection of quality assurance and quality control issues to Mr. F. lnzirillo, Manager,Quality Assurance, and other members of the licensee staff. The licenseeacknowledged the issues presented. The inspector asked the licensee whether anymaterials examined during the inspection should be considered proprietary. Noproprietary information was identified.On January 19,2Q11, the inspectors presented the inspection results of the integratedinspection to Mr. Joseph Pollock, Site Vice President, and other members of the Entergystaff. The licensee acknowledged the findings and observations presented. Theinspectors asked whether any materials examined during the inspection should beconsidered proprietary. No proprietary information was identified.4C.A7 Licensee-ldentified ViolationsThe following violations of very low safety significance (Green) were identified byEntergy and are violations of NRC requirements which meet the criteria of the NRCEnforcement Policy, for being dispositioned as NCVs.o 1O CFR 50.47(bX4), requires that a standard emergency classification and actionlevel scheme, the bases of which include facility system and effluent parameters,is in use by the licensee. 10 CFR 50.54(q), states in part, that licensees shallfollow and maintain in effect emergency plans which meet the standards in50.47(b). Contrary to the above, on October 2Q,2010, during an extent ofcondition review of industry operating experience, Entergy personnel identifiedthat the R-54 radiation monitor's (monitor is for liquid effluent from the wastedistillate storage tanks) highest range of 4.7e-2 uCi/cc was below the value of2.5e-1uCi/cc required to declare an Alert using emergency action level (EAL)Table 5.1.Entergy personnel documented this issue in the CAP as CR-IP2-20'10-06417 andprovided timely guidance to the control room operators to ensure properclassification of an event. In addition, Entergy personnel performed an apparentcause evaluation which included an extent of condition of the issue. The EALEnclosure 56chart and associated emergency plan procedures were revised to reflect the EALchanges. The inspectors determined that this finding is of very low safetysignificance because it did not result in a significant degradation of the risksignificant planning standard function.o 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," requires, inpart, that the licensee establish a quality assurance program which complies withAppendix B. This program shall be documented by written policies, procedures,or instructions and shall be carried out throughout plant life in accordance withthose policies, procedures, or instructions. Procedure EN-QV-111, 'Training andCertification of InspectionA/erification and Examination Personnel," Section 4.0[4](i), requires that the Entergy corporate ANSI Level lll inspector shall performperiodic (annual) surveillances of quality control inspection activities to ensurethat the program is being adequately implemented and maintained. Contrary tothe above, no surveillances of quality control inspection activities were performedfor any Entergy site during calendar year 20Q8.The issue was not suitable for quantitative significance determination, so it wasassessed using IMC 0609, Appendix M, and evaluated using the qualitativecriteria listed in Table 4.1. This finding was determined to be of very low safetysignificance because other quality assurance program functions remainedunaffected by this performance deficiency, so defense-in-depth continued toexist. This issue was entered into the Entergy's CAP as CR-HQN-2009-00111.ATTACHMENT:
The inspectors' independent review did not identify unusual indications or degradation of concrete and re-bar. The inspectors determined that core samples appeared as described by Entergy personnel and the water chemistry was as expected.


=SUPPLEMENTAL INFORMATION=
The inspectors also noted the proper completion of license renewal commitments with respect to concrete core samples and water chemistry analysis of 2010. Further, the inspectors reviewed the report lP-RPT-1 1-00002 regarding Entergy's conclusion that the Reactor Fueling Cavity and the Fuel Handling Building Concrete retained the structural capacity to fulfill its design and safety function.


==KEY POINTS OF CONTACTS==
The inspectors' review determined that Entergy's evaluation was appropriate in its evaluation and conclusion that the design and safety function of the liner was maintained given the current condition and impacts regarding the leakage that occurs during refueling outages. The inspectors also discussed Entergy's plan for the permanent fix and verified that if remediation is unsuccessful for the leakage, then Entergy's corrective action process has provisions to continue to re-inspect the concrete, re-bar, and the leaking water prior to extended operation.
ite Vice PresidentEchelon Chief EngineerNDE Level lll, Code ProgramsSpecialist - Nuclear Safety/License lVSupervisor - EngineeringShift ManagerEchelon Manager - Fleet OperationsSpecialist - Nuclear Safety/License lVManager - System EngineeringManager - Dry Cask ProjectProject Manager - NUCSpecialist - Nuclear Safety/License lVEngineer lll- NuclearAssistant Plant ManagerShift ManagerEchelon General Manager - Plant Operations, Fleet Operations SupportShift ManagerManager - OperationsEchelon Senior Manager - Nuclear Safety and LicensingMaintenance Inspection CoordinatorManager - SecurityEchelon Manager - Quality AssuranceSupervisor - Radiation ProtectionManager - IPEC Quality AssuranceEchelon Senior Vice President - Planning, Development and OversightLead Engineer - Buried Pipe and Tank ProgramSuperintendent - l&CSenior Lead EngineerSpecialist - Senior HP/ChemicalManager - Design EngineeringWhite Plains Vice President - Nuclear Safety, Emergency Preparedness,and LicensingEchelon Senior Staff EngineerDirector * EngineeringEchelon Vice President - OversightShift ManagerSpecialist - Nuclear Safety/License lVSpecialist - Corrective ActionSuperintendent - SimulatorSuperintendent - Dry Fuel StorageSpecialist - Senior HP/ChemicalSenior Reactor OperatorSuperintendent - Licensed Operator Requal TrainingTechnical Specialist lVEchelon Director - OversightAttachment
 
M. TesorieroA. VitaleR. WalpoleE. WeinkamA. WilliamsOpen and Closed0500024712010-005-010500024712010-005-02 FIN05000247t2010-005-03 FrN0500024712010-005-0405000247 /2010-005-05NCVNCV0500024712010-005-060500024712010-005-07NCV0500024712010-005-08 Ncv0500024712010-005-09Closed0500024712010-007-00NCVA-2Manager * Programs and ComponentsGeneral Manager - Plant OperationsManager - LicensingWhite Plains Senior Manager - Nuclear Safety and LicensingManager - PS&O
As part of the inspectors' corrective action review of this condition, which included review of plant drawings, inspectors questioned the safety classification of the refueling cavity liner. Entergy staff evaluated the liner classification as documented in EC 21400.Entergy staff's EC evaluation determined that the refueling cavity liner did not meet the requirements to be classified as a safety-related component.
 
However, Entergy engineers determined the cavity liner met station requirements to be classified as an augmented quality (QP) component, which is an SSC that is not safety-related but may require additional quality level oversight.
 
The Entergy QP designation imposes formal requirements on liner design, materials, and work methods to maintain greater control over liner-related activities.
 
The inspectors reviewed the EC and verified Entergy personnel had followed their procedures and processes for determining the safety classification of the liner.Additionally, inspectors questioned whether the wetted SSCs were being properly addressed in accordance with procedure EN-DC-319, "lnspection and Evaluation of Boric Acid Leaks." The inspectors noted that procedure EN-DC-319 required, "For non-white, wet, or excessive leaks, a BAC [Boric Acid Corrosion]
Evaluator shall evaluate the leak using guidance established in Attachment 9.4." The inspectors noted that, contrary to this procedural reguirement, Entergy technical staff had not completed an Attachment 9.4 evaluation for the wetted components in the 46 foot level of containment.
 
Entergy personneldocumented this issue as CR-lP2-2010-02628 and completed Attachment 9.4. Using the EPRI Boric Acid Guidebook, engineering personnel calculated the expected corrosion rates for the given temperature range and time duration of exposure.
 
The evaluation determined that, due to the moderate Enclosure 35 temperatures and limited exposure time (wetting only occurs during cavity flood up, which is less than three weeks every two years), the pumps, valves, piping, associated components and their supports would not be significantly impacted by boric acid corrosion.
 
The inspectors reviewed Entergy's evaluation and determined that it adequately addressed the impact of the refueling cavity leakage on the equipment in the 46 foot level of containment.
 
In addition, the inspectors conducted several walkdowns of the 46 foot level of containment during 2R19 and verified that the SSCs were not experiencing external corrosion due to the borated water. The inspectors also ensured Entergy personnel were following procedure EN-DC-319 to review and evaluate any dry boric acid found on these components at the start of each refueling outage.The inspectors determined that not following the requirements of procedure EN-DC-319 was a performance deficiency.
 
Specifically, Entergy technical staff did not evaluate the wet boric acid leak on the 46 foot level of containment until questioned by the NRC. The inspectors reviewed this performance deficiency in accordance with NRC IMC 0612 Appendix B and determined that it constituted a performance deficiency of minor significance because there was no safety impact on equipment, and because Entergy engineers performed evaluations of the dry boric acid accumulated throughout the cycle at the beginning of each refueling outage.The inspectors further reviewed procedure EN-tl-102, "Corrective Action Process," Step 5.2.e, which states, "Employees are required to initiate condition reports for adverse conditions." Attachment9.2 of this procedure gives examples of adverse conditions such as "Conditions affecting a safety related, quality related or trip sensitive system caused by a deficiency in characteristic, documentation or procedure that renders the quality of an item unacceptable or indeterminate.
 
The inspectors reviewed procedure EN-OP-104, "Operability Determination Process," Step 5.1.5, "SSCs warrant functionality assessments within the processes used to address degraded and nonconforming conditions because they perform specified safety functions described in the UFSAR." The UFSAR Section 9.5.1.4, "Protection Against Radioactivity Release from Spent Fuel and Waste Storage," states, "The reactor cavity, refueling canal and spent fuel storage pit are reinforced concrete structures with a seam-welded stainless steel plate liner. These structures are designed to withstand the anticipated earthquake loadings as seismic Class I structures so that the liner prevents leakage even in the event the reinforced concrete develops cracks." The inspectors identified a performance deficiency because Entergy personnel did not fully implement procedures EN-Ll-102 and EN-OP-104.
 
Specifically, while condition reports were initiated for the leak each refueling outage when they occurred, Entergy personnel did not perform a functional assessment to evaluate the reactor cavity liner leakage each refueling outage when the condition existed. Entergy personnel initiated CR-lP2-2010-06741 and conducted a past functionality assessment.
 
Entergy personnel determined that the leakage condition, when present, was a condition not consistent with the reactor cavity liner's UFSAR described design function; however, Entergy personnel determined the leakage condition did not have a safety impact on the liner's functionality.
 
The inspectors reviewed this performance deficiency in accordance with IMC 0612 Appendix B and determined that it constituted a performance deficiency of minor significance because the non-conforming leakage condition did not have a safety impact on the equipment or the liner attachment welds and carbon steel hardware that support liner functionality.
 
Entergy personnel have developed a recurring step in the outage plan to write a condition report and evaluate the leaking condition, until repaired, to ensure Enclosure
 
===.5 36 there is no impact on equipment.===
 
This recurring task is documented in LO-OLl-2010-00140. Entergy personnel continue to implement and evaluate corrective actions (CR-lP2-2008-01629)to correct the liner leakage and restore the condition of the liner to as described in the UFSAR.ln general, based on the review of Entergy's corrective actions for the reactor cavity liner leakage condition, the inspectors concluded that Entergy personnel are following their CAP for evaluating and resolving the leakage. Entergy staff prioritized this issue commensurate with the safety significance of the problem, and for the long term corrective actions, is performing the required yearly periodic assessment.
 
Station personnel have been following their process for identifying and evaluating the dry boric acid residue in accordance with procedure EN-DC-319.
 
However, as described above, the inspectors determined that each refueling outage, site personnel did not specifically screen the leakage appropriately for liner functionality and evaluate the interim wet boric acid conditions.
 
The inspectors have completed their review of URI 0500024712010002-02.
 
Two minor performance deficiencies were identified as noted above. Specific documents reviewed during this inspection are listed in the attachment.
 
This URI is closed.Selected lssue Follow-up Inspection Inspection Scope An inspection was performed at the Entergy corporate office in Jackson, Mississippi on June 14 through 17 ,2010, to review the circumstances surrounding missed quality control (QC) verification inspections documented in CR-HQN-2009-01 184 and CR-HQN-2O10-00013.
 
The issue involved QC verification inspections performed during construction-related activities which were required as part of the Entergy quality oversight and verification programs.
 
The inspection was performed to determine if the licensee had taken corrective actions commensurate with the significance of the identified issues, and to assess the impact, if any, on the operability of plant equipment caused by the missed inspections.
 
This inspection was conducted by inspectors from Regions l, ll, and lV, as well as a Senior Program Engineer from the Quality and Vendor Branch of the Office of Nuclear Reactor Regulation (NRR). The inspection covered all NRC-licensed sites owned by Entergy Operations, lnc., including Arkansas Nuclear One, James A. Fitzpatrick, Grand Gulf Nuclear Station, Indian Point Units 2and 3, Palisades Plant, Pilgrim Nuclear Power Station, River Bend Station, Vermont Yankee, and Waterford 3.The inspectors reviewed root cause analyses documented in CR-HQN-2009-01 184 and CR-HQN-2010-00013, and the results of the licensee's extent of condition reviews and plant impact assessments.
 
The inspectors also independently assessed the potential impacts of the missed inspections on the operability of plant equipment by reviewing all of the examples identified by the licensee, and by independently reviewing completed modifications and work orders to identify additional examples.
 
The inspectors also reviewed the corrective action database to assess reported equipment failures in order to assess whether the failure might have involved missed QC verification inspections.
 
The inspectors assessed causalfactors that may have contributed to missing QC verification inspections.
 
This assessment included reviewing the Entergy Quality a.Enclosure b.37 Assurance Program Manual(OAPM)requirements, changes made to the QAPM, and the level of agreement between the QAPM and its implementing procedures.
 
Specific documents reviewed are listed in the attachment.
 
Findinqs and Observations The inspectors identified problems with the implementation of elements of the Quality Assurance (QA) Program that affected the fleet of Entergy Operations Inc., (hereafter referred to as "Entergy")
nuclear power plants that are licensed by the NRC. While the plant organizations are NRC licensees, Entergy also has corporate groups which are not NRC licensees that are actively involved in some activities affecting sites, including program and procedure changes. Entergy adopted a business strategy of adopting standard programs and procedures at allfleet plants.On October 30, 2009, the NRC discussed with Entergy personnel the initial concerns about whether QC verification inspections were being performed consistently for the types of work that require that level of inspection.
 
Both the non-licensed and licensed Entergy organizations responded with an appropriate review of the issues. Entergy's review of work documents that were potentially affected was extensive at each site.Entergy's total review examined over 320 Engineering Change documents and 2676 work orders. Of the 30 work orders identified to have QC verification inspection deficiencies affecting eight safety-related design changes, all 30 were determined by Entergy personnel to have sufficient documentation to provide confidence that the equipment was installed correctly.
 
Specific corrective actions were identified and implemented to ensure that QC verification inspections would be included in current and future work documents, including procedure enhancements.
 
The information provided to the NRC was used to perform a focused inspection in order to assess the impact of the missed verification inspections at each of the NRC-licensed facilities.
 
The inspection documented below independently assessed the potential impact of missed QC verification inspections on the operability of plant equipment, as well as assessing details of QA Program for the Entergy fleet.Two findings were identified during this inspection.
 
These findings involved missed QC verification inspections at seven Entergy sites, and the assignment of individuals to the QA Manager position that did not meet the experience and qualification requirements at eight sites. Only the findings impacting lndian Point are described below.The inspectors concluded that the Entergy fleet organizational structure and Entergy strategy of adopting standardized procedures across the fleet were contributing factors to the findings.
 
Specifically:
o Changes to adopt the standard fleet QA program created a partially conflict with existing requirements for worker qualifications at some sites. The process for creating and revising standardized fleet procedures and programs used to meet NRC requirements must ensure that site-specific regulatory requirements and commitments are properly addressed for all sites; and. Changes that removed details from existing site-specific QA and QC program implementing procedures while shifting to standardized fleet procedures contributed to the finding involving missed QC verification inspections.
 
Condition reports at Enclosure 38 individual sites regarding problems related to this issue were not recognized collectively as symptoms of a problem with these procedures because they were addressed at the site level.(1) Failure to Perform Required Qualitv Control Inspections lntroduction.
 
The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion X, "lnspection," because Entergy personnel did not ensure that quality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for construction-like work activities as required by the QAP.Description.
 
In response to the inspectors request for information concerning implementation of the quality oversight and verification programs, the licensee performed a review of a representative sample of engineering changes and work order tasks issued between 2006 and 2009. The licensee's review included performing equipment walkdowns, evaluating rework rates and human error rates, and causes for failures of significant components.
 
Based on the results of these reviews, Entergy initiated CRs at the various sites to document problems with Quality Control (QC)verification activities and failures to perform required QC reviews of safety-related engineering changes and construction related work activities.
 
Entergy's investigation concluded that procedures contained inadequate guidance, which resulted in inconsistent implementation of the QC Program. Specifically, some safety-related design change work orders were not reviewed to determine whether QC verification inspections were required, and some safety-related design change work orders did not include all required QC verification inspections.
 
These examples were documented in CR-HQN-2009-01083, -01084, -01085, -01093, -01096, -01140, -01169, -01170, -01184, and -01188.Additional findings identified by Entergy's review included: o Managers in maintenance organizations did not have a detailed understanding of QC responsibilities, required inspections, or what documents required review (CR HON-2009-01 150);. A weakness was identified in the process for ensuring proper approval of contract QC inspection personnel at all Entergy sites. Procedure EN-QV-1 11, "Training and Certification of Inspection/verification and examination Personnel," Section 4.0 [1], required that the Manager responsible for Quality Assurance or designee at each location is responsible for approving ANSI N45.2.6 certification of QC inspection personnel.
 
ln practice, contract QC inspectors'qualifications were not approved by the QA Manager prior to November of 2009. This was determined to be a minor violation because the ANSI Level lll inspector at each site was documenting that the contract QC personnel had the necessary qualifications to perform the inspections for which they were contracted.
 
This issue was entered into the Entergy's CAP as CR-HQN-2009-1091; r At individual Entergy plants, 27 CRs were written in 2008 and 2009 to document potentially missed QC verification inspections or missed reviews to consider QC verification inspections prior to the NRC engaging Entergy on this issue. Of those, seven were actual missed inspections (CR-RBS-2009-05041, CR-JAF-2008-03648, and CR-PNP-2008-0091 6 and CR-PNP-2 008-03922, CR-PNP-2009-01798, CR-PNP-2009-02059, and CR-PN P-2009-02255).
 
Multiple CRs documented work Enclosure 39 paekage quality issues that impacted the ability to identify appropriate QC verification inspection req uirements; r Two examples of QC programmatic issues were identified, assigned the Entergy headquarters, and not properly addressed (CR-ANO-C-2009-01884, and CR-HQN-2009-00178).
 
These were considered examples of the violation discussed below;r Although equipment-related QC CRs were addressed appropriately, QC programmatic issues were not always effectively addressed; and. QA audits and oversight activities for the QC Program missed opportunities to identify the findings of their investigation (CR-HQN-2009-01169, CR-HQN-2009-0153, and CR-HQN-2010-00013).
 
ln particular, the Entergy corporate ANSI Level lll inspector was required to perform periodic surveillances of QC inspection activities to ensure the program is being adequately implemented and maintained, but these required surveillances were not performed in 2008 (CR-HON-2009-001 1 1). This is further discussed in Section 4OA7.Subsequent to the identification of these deficiencies, Entergy personnel initiated corrective actions to ensure that appropriate safety-related, engineering changes and non-routine maintenance work orders were identified and routed to the Maintenance lnspection Coordinator for evaluation and inclusion of QC verification inspections in accordance with the revised requirements of procedure EN-WM-105, "Planning." These corrective actions and actions to preclude recurrence were collectively documented in the following Level A CRs: CR-HQN 2009-01 184, dated December 21, 2009 and CR-HQN-2010-0013, dated January 6, 2010.In-office NRC reviews identified the need to conduct further inspection activities, On June 14 through 17 , 2Q10, the inspectors conducted a focused review of work performed at each NRC-licensed Entergy site to assess whether examples of missed QC verification inspections identified by Entergy during their review had the potential to have impacted the operability of important plant equipment.
 
The inspectors also reviewed the corrective action database and maintenance records to independently assess the rigor of the Entergy review and to identify additional examples of missed QC verification inspections.
 
The inspectors identified no additional examples, and concluded that the Entergy reviews were sufficient to identify the scope of the problems and develop actions to address the causes.The inspectors' reviewed specific work items whose scope met QAPM requirements to have had QC verification inspections but did not have the appropriate inspections.
 
Based in part on interviews with Entergy personnel, the inspectors determined that procedural guidance for work planning was not sufficiently detailed or clear to ensure that work packages with construction-like activities would be reviewed by the specified QC personnel.
 
These individuals were responsible for designating the QC inspections that were required by the QAPM.The inspectors also identified numerous CRs written at Entergy sites that documented improper implementation of QC verification inspections.
 
Specific CRs are listed in the attachment.
 
Analvsis.
 
The performance deficiency associated with this finding was that Entergy personnel did not ensure that ouality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for Enclosure 40 construction-like work activities as required by the QAP, This finding is more than minor because it's a programmatic deficiency that if left uncorrected, could lead to a more significant safety concern in that the failure to check quality attributes could involve an actual impact to plant equipment.
 
This finding affected the design control attribute of the Mitigating Systems cornerstone because missed quality control inspections during plant modifications could impact the availability, reliability, and capability of systems needed to respond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding is a qualification deficiency confirmed not to result in a loss of operability or functionality.
 
Specifically, inspectors verified by sampling that work documents provided objective quality evidence that work activities that had missed quality control verifications were properly performed.
 
The finding has a cross-cutting aspect in the area of human performance associated with the decision-making attribute because the licensee did not have an effective systematic process for obtaining interdisciplinary reviews of proposed work instructions to determine whether quality control verification inspections were appropriate.
 
[H.1(a)per IMC 03101 (Section 4OA2.1.1)Enforcement.
 
10 CFR Part 50, Appendix B, Criterion X, "lnspection," requires, in part, that examinations, measurements, or tests of material...
shall be performed for each work operation where necessary to assure quality . . . lf mandatory inspection hold points, which require witnessing or inspecting by the licensee's designated representative and beyond which work shall not proceed without the consent of the designated representative are required, the specific hold points shall be indicated in appropriate documents.
 
Entergy's QAPM, Revision 20, Section B.12., "lnspection" requires, in part, that: "Provisions to ensure inspection planning is properly accomplished are to be established.
 
Planning activities are to identify the characteristics and activities to be inspected, the inspection techniques, the acceptance criteria, and the organization responsible for performing the inspection.
 
Provisions to identify inspection hold points, beyond which work is not to proceed without consent of the inspection organization, are to be defined." Contrary to the above, from February 2006 to December 2009, the licensee failed to ensure that examinations, measurements, or tests of material were performed for each work operation where necessary to assure quality, and failed to include mandatory inspection hold points in appropriate documents.
 
Specifically, multiple examples of Maintenance Work Orders and Engineering Change documents for construction-related activities involving safety-related systems structures and components were identified where witnessing or inspections were required to be performed to ensure quality, but these steps were not identified, included in the work documents, or performed as required QC hold points in the work instructions.
 
Condition reports documenting the specific problems and examples of the violation included: cR-lP2-2009-05321 cR-1P2-2009-05399 cR-HQN-2009-01085 cR-tP2-2009-05348 cR-tP3-2009-04883-cR-HQN-2009-01083 cR-tP2-2009-05400 cR-rP2-2009-05389 cR-HQN-2009-01084 41 CR-HQN-2009-01093 CR-HQN-2009-01096 CR-HQN-2009-01169 CR-HQN-2009-01170 cR-HQN-2009-01 188*determined to be related to Unit 2 CR-HQN-2009-01 140 cR-HQN-2009-01 184 Because this finding was of very low safety significance and was entered into Entergy's CAP as CR-HQN 2009-01 184 and CR-HQN-2O10-0013, consistent with Section 2.3.2 oI the Enforcement Policy, this violation is being treated as a NCV: NCV 0500024712010005-04, Failure to Perform Required Quality Control Inspections.
 
(2) Failure to lmplement the Experience and Qualification Requirements Associated With the Qualitv Assurange Prooram lntroduction.
 
The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," because Entergy personnel did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of quality assurance manager (OAM) met the qualification and experience requirements of ANSI/ANS 3.1-1978.
 
Specifically, the individual assigned as the responsible person for the Entergy's overall implementation of the QAP did not have at least 1 year of nuclear plant experience in the overall implementation of the QAP within the quality assurance organization prior to assuming those responsibilities.
 
=====Description.=====
During their review of the issues surrounding the improper implementation of quality control (QC) verifications discussed above, the inspectors noted that the root cause analysis documented in CR-HQN-2O10-0013 identified that lack of experience of the Quality Assurance (QA) Manager contributed to the failure to identify the trend in missed QC verification inspections.
 
The inspectors reviewed the relevant experience and qualifications of the QA Manager at each Entergy site. The inspectors also reviewed the NRC's safety evaluation report that approved Entergy's original corporate Quality Assurance Program Manual (QAPM), which is the document that contains the QA Program, Additionally, the inspectors reviewed the administrative section of the Technical Specifications for all the Entergy sites and a sample of evaluations, performed in accordance with 10 CFR 50.sa(a), that supported Entergy QAPM changes and alignment of plants that.were subsequently purchased by Entergy.The Entergy corporate QAPM required each site to meet the experience and qualification standards in ANSI/ANS 3.1-1978, "American National Standard for Selection and Training of Nuclear Power Plant Personnel." Section 4.4 included qualification and experience requirements for the personnel described as "group leaders" of five professional{echnical groups, including Quality Assurance.
 
Section 4.4.5, "Quality Assurance," required that ". ..the responsible person shall have six years experience in the field of quality assurance, preferably at an operating nuclear plant, or operations supervisory experience.
 
At least one year of this six years experience shall be nuclear power plant experience in the overall implementation of the quality assurance program. (This experience shall be obtained within the quality assurance organization.)" On December 15, 2008, procedure EN-QV-1 17, "Oversight Training Program," the Entergy procedure used by all Entergy sites to implement the requirements of ANSI/ANS 3.1-1978, was revised by the Entergy corporate QA group. Section 5.7, "Manager/QA Senior Auditor Training," was changed to state: Enclosure 42 Either the QA Manager or the Senior QA Auditor will meet the requirements of ANS 3.1-1978 paragraph 4.4.5'for operating plants and if applicable ANS 3.1-1993 paragraph 4.3.7 for new plants.The inspectors reviewed completed Personnel Change Planning ChecklisUForms for QA Managers at each site. Entergy used this form to evaluate QA manager candidates prior to the implementation of an Entergy fleet-wide restructuring in July 2007. Attachment 8,"Change Management Guidelines for Alignment lmplementation," included the following conclusion for the individual that subsequently was assigned to be the QA Manager: Individual's name redacted]
meets the minimum requirements for QA Manager with the exception of at least one year of this six years experience shall be nuclear power plant experience in the overall implementation of the quality assurance program. This requirement must be met by the QA Senior Auditor.Based on discussions with Entergy corporate QA personnel, the inspectors determined that Entergy personnel had interpreted ANSI/ANS 3. 1-1978, Sections 4.4 and 4.4.5 to allow the Senior Auditor to be considered the QA group leader described in the standard for purposes of meeting the experience reguirements of Section 4.4.5 in cases where a candidate for the position of QA Manager did not satisfy the experience requirements.
 
In reviewing this issue, the NRC staff has determined that the group leader in this case is the individual filling the position assigned responsibility for overall implementation of the QA Program (Entergy used the title "QA Manager" for this position).
 
The individual meeting the experience and qualification requirements must be the individual assigned the responsibilities for overall implementation of the QA Program assigned within the QA Program.The inspectors determined that this change to procedure EN-QV-117 did not ensure that the qualifications for the QA Manager would meet the requirements of standard.
 
The inspectors identified an example where the Senior Auditor was credited as being the group leader for purposes of meeting ANSI/ANS 3.1-1978, and the individual who was assigned as the QA Manager did not meet the ANSI/ANS 3.1-1978 experience requirements.
 
The team also determined that the responsibilities assigned to the QA Manager under the QAPM were not reassigned to the Senior Auditor, and the Senior Auditor did not report directly to the designated senior executive.
 
The Senior Auditor continued to report to the QA Manager, so the person with the greater experience did not have the positional authority to decide issues.Analvsis.
 
The performance deficiency associated with this finding was that Entergy did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of QAM met the qualification and experience requirements of ANSI/ANS 3.1-1978.
 
This finding is more than minor because if left uncorrected, it could lead a more significant safety concern. Specifically, the failure to have a fully qualified individual providing overall oversight to the QAP had the potential to affect all cornerstones.
 
However, this finding will be tracked under the Mitigating Systems cornerstone as the area most likely to be impacted.The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.
 
Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the Enclosure 43 finding to be of very low safety significance (Green) because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist.The inspectors determined that there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy' current performance.
 
Specifically, the performance deficiency occurred more than three years ago and was outside the current assessment period.Enforcement.
 
10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," requires, in part, that the licensee establish a quality assurance program which complies with Appendix B. This program shall be documented by written policies, procedures, or instructions and shall be carried out throughout plant life in accordance with those policies, procedures, or instructions.
 
The program shall provide for indoctrination and training of personnel performing activities affecting quality as necessary to assure that suitable proficiency is achieved and maintained.
 
The Entergy Quality Assurance Program Manual, Revision 13, is the document used at each Entergy-owned site to describe the quality assurance program. Table 1, Section A of the Quality Assurance Program Manual states, in part, that qualifications and experience for station personnel shall meet ANSI/ANS 3.1-1978 except for positions where an exception to either ANSI/ANS 3.1-1978 or N18.1-1971 is stated in the applicable unit's Technical Specifications.
 
ANSI/ANS 3.1-1978, Section 4.4.5, "Quality Assurance," states, in part, that the responsible person (i.e. the Quality Assurance Manager) shall have six years experience in the field of quality assurance.
 
At least one year of this six years experience shall be obtained within the quality assurance organization.
 
Contrary to the above, between July 7,20Q7 and July 8, 2008, the licensee failed to implement the quality assurance program requirements intended to provide indoctrination and training of personnel performing activities affecting quality as necessary to assure that suitable proficiency was achieved and maintained.
 
Specifically, the individual assigned to be the responsible person for the licensee's overall implementation of the Quality Assurance Program did not have at least 1 year of nuclear plant experience in the overall implementation of the Quality Assurance Program within the quality assurance organization prior to assuming those responsibilities.
 
Because this finding was of very low safety significance and was entered into Entergy's CAP as CR-HQN-2010-00386, consistent with Section 2.3.2 of the Enforcement Policy, this violation is being treated as a NCV: NCV 0500024712010005-05, Failure to lmplement the Experience and Qualification Requirements of the Quality Assurance Program.Enclosure 40A3 44 Event Follow-Up (71153 - 3 samples)(Closed) Licensee Event Report 05000247/2010-007-00, Automatic Reactor Trip Due to a Turbine Trip as a Result of a Hiqh Steam Generator Level Trip After Transition to Sinqle Feedwater Pump Operation Inspection Scope On September 3, 2010, during a scheduled plant shutdown, an automatic reactor trip occurred at approxim ately 41%o power as a result of a turbine trip due to a high steam generator (SG) water level. The inspectors evaluated the response of control room personnel and plant equipment following the automatic reactor trip as described in NRC lnspection Report 0500024712010004.
 
Entergy personnel determined that the root cause of the eventwas inadequate design controlof the proportional band and reset tuning settings for critical plant controllers; and that there was less than optimum settings on the MBFP speed controller, feed regulatory valve flow controllers, and the SG level controllers for low power operations.
 
The immediate corrective actions included changing the MBFP speed controller settings to the optimum settings.
 
Entergy personnel documented the root cause evaluation in CR 1P2-2010-05484.
 
This LER is closed.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one event follow-up sample as defined in NRC Inspection Procedure 7 1 153.Findinqs lntroduction.
 
A Green self-revealing finding was identified because Entergy's procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control," did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations, contributing to a reactor trip from 41o/o power during a planned shutdown on September 3, 2010.Description.
 
On September 3, 201A, during a planned shutdown to repair the 21 reactor coolant pump, an automatic reactor trip occurred as a result of a turbine trip due to a high steam generator (SG) water level. Prior to the event, operations personnel had reduced reactor power from 100% to 41o/o with both MBFPs in operation.
 
Operators removed the 21 MBFP from service as planned, and the 22 MBFP increased in speed to make up for the 21 MBFP being removed from service. However,22 MBFP was slow to increase in speed, resulting in a decrease in water levelto allfour SGs. The 22MBPF continued to increase in speed and flow even when SG level began to recover, causing an increase in SG water level. Due to the increasing SG water level, operators took manual control of the 24feed regulation valve (FRV) to reduce feedwater flow. The 22 and 23 FRVs automatically responded by reducing flow to the 22 and 23 SGs.Operations personnel also took manual control of the 21 FRV to reduce flow to hhe 21 SG. The decrease in flow to the 21 and 24 SGs resulted in an increase in feedwater flow to the 22 and 23 SGs, until the high level trip setpoint was reached in the 23 SG, and a turbine trip and reactor trip was automatically initiated per the plant design.Entergy personnel performed a root cause evaluation (CR-lP2-2010-5484), and determined the root cause was inadequate design control of the proportional band and ,1 Enclosure 45 reset tuning settings for critical plant controllers.
 
Entergy personnel determine there were less than optimum controller settings on the MBFP speed controller, feed regulatory valve flow controllers, and steam generator level controllers for low power operations.
 
Entergy personneltook immediate corrective actions to change the MBFP speed controller settings.
 
Entergy's corrective actions included reviewing l&C procedures to ensure that the instrument calibration requirements matched l&C preventative maintenance documents, and a list of critical controllers was generated and the Equipment Data Base (EDB) updated with known controller settings.
 
Entergy's planned corrective actions include reviewing l&C procedures to identify changes to ensure controller calibrations maintain required settings, reviewing procedures to incorporate testing of critical parameters, and issuing an engineering evaluation and updating the EDB in the work control program with findings on controller settings.The inspectors reviewed a design change on May 5,2Q06, where Entergy staff processed a change to remove the settings for the MBFP speed controllers from l&C Procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control." As a result, the MBFP speed controller settings were not maintained at the proper settings.
 
The inspectors determined the change was processed through DRN-06-02146 inappropriately as an editorial change and not a technical change and thus did not receive a cross-disciplinary review and user validation required by procedure lP-SMM-AD-102, "IPEC lmplementing Procedure Preparation, Review, and Approval." The speed controller settings caused a slower response of the 22MBFP after the 21 MBFP was removed from service. The inspectors determined that without prescribed MBFP speed controller settings, that l&C procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control," was not adequate to ensure proper operation of the MBFPS.Analvsis.
 
The performance deficiency associated with this finding was that Entergy's procedure 2-lC-PC-N-P-408A did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations.
 
This finding is more than minor because it is associated with the design control attribute of the Initiating Events cornerstone and affects the cornerstone objective of limiting the likelihood of those events that upset plant stability and challenge critical safety functions during power operations.
 
Specifically, inadequate design control of the MBFP speed controller settings contributed to a reactor trip.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding did not contribute to the likelihood that mitigation equipment or functions would not be available, The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect current licensee performance.
 
Specifically, the performance deficiency occurred several years ago and was outside the current assessment period.Enforcement.
 
This finding does not involve enforcement action because no regulatory requirement violation was identified.
 
Because this finding does not involve a violation, has very low safety significance, and it was entered into Entergy's CAP as CR 1P2-2010'05484, it is identified as a finding: FIN 500024712010005-06, Inadequate Main Boiler Feed Pump Speed Gontroller Setting.Enclosure 46.2 Automatic Reactor Trip on Turbine Trip Due to 21 Main Transformer Failure lnspection Scope The inspectors reviewed the below listed event for plant status and mitigating actions to evaluate Entergy performance and confirm that Entergy operators implemented actions and notifications (if required)in accordance with station procedures.
 
The inspectors also reviewed Entergy's emergency response actions to evaluate Entergy staff performance and confirm that Entergy staff implemented actions and notifications in accordance with station procedures for the Alert declaration.
 
At 1839 hours on November 7, 2010, Unit 2 experienced a reactor trip. At 1841 , the Unit 2 control room operators were informed that that there had been an explosion in the Unit 2 transformer yard/diesel generator building area. The station fire brigade was activated to respond to the notification of explosion.
 
Soon thereafter, a second explosion occurred, and this one was felt and heard in the Unit 2 control room. At 1849, the Unit 2 Shift Manager declared an Alert emergency based on reports of two explosions in the transformer yard (Entergy subsequently determined that both explosions were the result of the 21 main transformer failure).
 
The Alert declaration was made in accordance with emergency action level (EAL) 8.2.3, which states "fire or explosion in any plant area, Table 8.1, which causes or potentially causes any required safety related system or structure to become inoperable." The diesel generator building/fuel tank area is listed in Table 8.1. The operation's crew activated the IPEC emergency response organization (ERO) to respond to the event. Entergy staff terminated the emergency at 2218 hours.The inspectors evaluated the response of control room personnel following the automatic reactor trip that occurred as a result of the failure of 21 main transformer.
 
The inspectors reviewed plant computer data, including the sequence of events report, evaluated plant parameter traces, and discussed the event with plant personnel, to verify that plant equipment responded as expected, and to ensure that operating procedures were appropriately implemented.
 
The inspectors also verified that Entergy's post trip review group (PTRG) identified the most probable cause(s) of the trip to facilitate corrective actions prior to restart. This event and the PTRG report were entered into Entergy's CAP as CR-lP2-201 0-0680't.The inspectors also reviewed Entergy actions and decision making to verify decisions were consistent with a conservative approach to assessing the condition and in accordance with the site emergency plan. The inspectors reviewed logs and records from the night of the event, interviewed operational and emergency planning staff, and reviewed Alert Report and other corrective action documentation.
 
Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one event follow-up sample as defined in Inspection Procedure 71153.Findinqs No findings were identified associated with the operational response to the reactor trip.b.Enclosure 47 There were two findings identified regarding Entergy staff's implementation of the emergency plan. The inspectors will conduct further review of the root cause evaluation (RCE) and associated corrective actions in conjunction with review of the licensee event report to be submitted by Entergy personnel.
 
(1) Failure to Staff the TSC and OSC within the Required Time Limit
 
=====Introduction.=====
A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q) was identified because Entergy staff did not adequately implement the requirements of the IPEC Emergency Plan.Description.
 
On the evening of November 7,2010, the Unit 2 operating crew declared an Alert emergency at 1849 hours. At 1852 hours, the crew activated the Dialogic System, which notifies the site ERO of the event and requires the augmentation of the on-shift ERO by the on-call responders.
 
The IPEC Emergency Plan, Section H, Emergency Facilities and Equipment, requires that the TSC and OSC be operational within 60 minutes after a declaration of an Alert, Site Area Emergency, or General Emergency.
 
The TSC was staffed and declared operational at 2008 hours, and the OSC was staffed and declared operational at 2015 hours. Both of these activation times exceeded the 60 minute staffing requirement in the IPEC Emergency Plan.Entergy determined that two factors contributed to the failure to staff the emergency response facilities in the required time. First, there were notified ERO members who questioned the validity of the beeper indications or believed that other ERO members would respond, and therefore did not respond to their assigned emergency response facility.
 
Entergy determined this behavior was not in accordance with the IPEC ERO augmentation design and training nor consistent with station expectations.
 
Second, during the event, problems occurred with the beeper and phone systems used for ERO call-in. Some of the ERO responders indicated that the system recording stated there was no emergency, while other personnel received a beep but were unable to call in.The failure to comply with the requirements of the IPEC Emergency Plan resulted in Entergy's failure to comply with NRC regulations for timely augmentation of emergency response capabilities.
 
Entergy personnel documented the station's performance during the Alert emergency in an event report, and initiated several condition reports to address deficiencies in equipment and personnel performance.
 
CR-lP2-2010-06870 was written to investigate and correct the condition that the TSC and OSC did not meet minimum required staffing within the required 60 minutes. CR-lP2-2010-6813 and CR-IP2-2010-6831 were initiated to address the reported technical problems with the beeper and phone system, while CR-lP2-2010-6871 was written to address why certain individuals on the on-call ERO team did not report to the site or were late.The inspectors reviewed the event report and the CRs to assess the adequacy of Entergy's self-assessment and of the planned corrective actions. The inspectors determined that Entergy had identified the causes of the November 7 staffing issues and concluded that actions taken and planned corrective actions were adequate.Analvsis.
 
The performance deficiency associated with this finding was that Entergy personnel did not meet the requirements of the IPEC Emergency Plan in that the TSC and OSC were not staffed nor declared operational within 60 minutes of the Alert Enclosure 48 emergency declaration on November 7,2010. This finding is more than minor because it affected the Emergency Response Organization attribute of the EP Cornerstone to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.2 and Sheet 2, "Actual Event lmplementation Problem," and determined that the failure to comply with an aspect of the Emergency Plan related to ERO augmentation (10 CFR 50.47(b)(2))
was a non-risk-significant planning standard problem which occurred during an Alert emergency and is therefore a Green finding.This finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute of defining and effectively communicating expectations regarding procedural compliance and personnel following procedures.
 
Specifically, Entergy staff did not comply with ERO expectations and procedures regarding prompt reporting to an assigned emergency response facility during an actual event. [H.a(b) per rMc 03101
 
=====Enforcement.=====
10 CFR 50.54(q) requires, in part, that a licensee "shallfollow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX2)requires, in part, that"timely augmentation of response capabilities is available." Contrary to the above, on November 7, 2010, the IPEC ERO did not respond and staff the site TSC and OSC in a timely manner. The IPEC Emergency Plan requires that these facilities be staffed and operational within 60 minutes of an Alert emergency declaration.
 
On November 7, the TSC was declared operational 79 minutes after the Alert declaration, and the OSC 86 minutes after the declaration.
 
By failing to meet the requirements of the IPEC Emergency Plan, and therefore 10 CFR 50.47(b)(2), Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan. Entergy initiated training and counseling corrective actions to address the personnel performance issues and equipment issues. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR- lP2-2010-6813, -6831, and -6870, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 00500024712010005-07, Failure to Staff the Site TSC and OSC within 60 Minutes of an Alert Emergency Declaration.
 
(2) Failure of Offsite Notification Procedure to Meet the Requirements of the Site Emerqencv Plan
 
=====Introduction.=====
The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q) because the Entergy EPIP for notification of offsite officials did not meet the requirements of the IPEC Emergency Plan.Description.
 
Following the declaration of the Alert emergency at 1849 hours on November 7, 2010, the central control room (CCR) crew entered EPIP IP-EP-210,"Central Control Room." Attachment 9.1, Shift Manager/POM (Emergency Director)Checklist, of the EPIP directs the Shift Manager to complete a NYS Radiological Emergency Data Form, Part 1 (Form EP-1), and then have the CCR Offsite Enclosure 49 Communicator email and fax the form to offsite authorities.
 
Using the radiological emergency communication system (RECS) and Form EP-4, the Offsite Communicator confirms receipt of the Part 1 Form by offsite authorities.
 
A note in Attachment 9.1 requires that notification of state and local authorities shall be initiated within 15 minutes of an Alert declaration.
 
The IPEC Emergency Plan, Section E, Notification Methods and Procedures, paragraph 1.b.5, requires in part that an immediate notification (within 15 minutes) of an Alert is made by the Shift Manager or his designee to the New York State and Westchester, Rockland, Putnam, and Orange Counties.
 
NRC regulations, specifically 10 CFR 50.47(bX5), require in part that "procedures have been established for notification, by the licensee, of State and local response organizations." On the evening of November 7, when the Offsite Communicator attempted, via a telephone conference line, to confirm receipt of the Part 1 Form, the communicator learned that a problem had occurred with the fax machine and the only offsite authority to have received the fax was New York State. Per the direction of the guidance in Form EP-4, the Offsite Communicator instructed the four county personnel on the telephone conference to obtain the Form 1 from the State. One of the county personnel requested the Offsite Communicator to read the Form 1 over the conference line. The Offsite Communicator complied with the request and read the Form 1 information to the four county personnel at approximately 1902 hours, within 15 minutes of 1849 hours.On November 8, 2010, in response to Entergy's event notification to the NRC, the Region I senior emergency preparedness inspector discussed the November 7 event with the IPEC Emergency Planning Manager. The inspector questioned that Form EP-4 provided for the delegation of Entergy's responsibility for notification, an apparent contradiction of Emergency Plan requirements.
 
Due to County staff intervention, the offsite notifications were adequately performed, but the NRC inspector identified that had the Offsite Communicator followed his procedural guidance, the notifications would not have been made in accordance with IPEC Emergency Plan requirements or with NRC regulations.
 
The inspector determined that Form EP-4 had provided for the deficient backup method since it was revised in July 2006. Entergy initiated in CR-lP2-2010-07563 to investigate and resolve Form EP-4 deficiency concerning the backup method for offsite notification.
 
Entergy personnel determined the problem encountered with the fax machine on the evening of November 7,2010, was due to a design flaw in the MIDAS software package used to construct the Form 1. The flaw involved a feature that would prevent sending the Form 1 file if the user attempts to send the file before a data compiling feature of the program has completed its function.
 
Entergy personnel concluded that on November 7, the Offsite Communicator had attempted to send the form too soon after data had been entered. The problems encountered with MIDAS were replicated after the event, and Entergy initiated software design changes to the MIDAS program to correct the timing deficiency.
 
The NRC reviewed the IPEC Emergency Plan and its associated EPlPs, reviewed records from the November 7,2010, event, and discussed the issue with IPEC and County personnel.
 
Further, the inspector reviewed the planned changes to Form EP-4 and the intended design changes to the MIDAS and fax software.
 
The inspector concluded the planned corrective actions appeared adequate to correct the problems identified as a result of the November 7,2010 event.Enclosure
 
===.3 50 Analvsis.===
 
The performance deficiency associated with this finding was that Entergy procedures allowed for a back-up notification process that did not comply with the requirements of the site emergency plan: the emergency plan requires that the Shift Manager or his designee notify the offsite authorities of an emergency declaration, while Form EP-4 directed the delegation of this responsibility to an offsite authority itself. This finding is more than minor because it affected the Emergency Response Organization attribute of the EP cornerstone to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.
 
In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.5 and Sheet 1, "Failure to Comply," and determined that the failure to comply with an aspect of the Emergency Plan related to event notification (10 CFR 50.47(bX5))
was a risk-significant planning standard (RSPS) problem. lt was not a RSPS functionalfailure of the IPEC event notification process, because the deficiency in the IPEC EPIP was in the backup method for offsite notification, and despite the procedural flaw offsite notifications were made in a timely and accurate manner on November 7,2Q10.The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect current licensee performance.
 
Specifically, the performance deficiency occurred greater than three years ago and was outside the current assessment period.Enforcement.
 
10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part, that a licensee "shall follow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX5)requires, in part, that "procedures have been established for notification, by the licensee, of State and local response organizations." Contrary to the above, since July 2006 Entergy IPEC EPIPs provided a backup notification method that delegated the licensee's responsibility for offsite notifications to an offsite authority.
 
The IPEC Emergency Plan and 10 CFR 50.47(bX5)require that the Entergy IPEC staff perform the notification of offsite authorities.
 
Due to this procedure deficiency, Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan. Entergy initiated corrective actions to correct Form EP-4 by having the Offsite Communicator read the Part 1 Form to the offsite authorities if the faxlemail method does not work. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR-lP2-2010-07563, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 005000247 and 005000286/2010005-08, Failure of Offsite Notification Procedure to Meet the Requirements of the Site Emergency Plan.Loaded Multi-Purpose Canister Stuck Durinq Transfer from the HI-TRAC Transfer Cask to a HI-STORM Storaqe Cask Inspection Scope The inspectors reviewed the below listed equipment problem for plant status and mitigating actions to evaluate Entergy personnel performance and confirm that the a.Enclosure b.51 Entergy staff implemented actions and notifications in accordance with station procedures.
 
From July through November 2010, Entergy personnel conducted a campaign to place selected spent fuel elements into dry cask storage. On November 18, 2010, during the stack up and transfer of a fully loaded Multipurpose Canister (MPC) MPC-32 canister from the HI-TRAC transfer cask into a HI-STORM storage cask, the MPC became lodged while partially inserted into the mating device. The MPC had been lowered approximately 8 inches into the mating device from the HI-TRAC, but became lodged and could not be lowered or raised with the fuel storage building (FSB) gantry crane.Through consultation with representatives of Holtec International (Holtec), the storage system vendor; and Ederer, the Unit 2 FSB gantry crane manufacturer; Entergy personnel determined the problem to be a result of a misalignment of the HI-TRAC and the mating device that joins the HI-TRAC to the HI-STORM for the MPC transfer.
 
After not being able to dislodge the MPC during the stack up and transfer on November '18, 2010, Entergy personnel, in consultation with Ederer personnel on site, bypassed the crane load cell so that the 90,000 pound limit could be exceeded.
 
The FSB gantry crane auxiliary hoist was slowly and incrementally raised. At approximately 100,000 pounds the MPC was successfully dislodged, the load cell dropped down to approximately 87,000 pounds, and the MPC was able to be raised back into the HI-TRAC. The HI-TRAC and MPC were then lifted off the HI-STORM and mating device and placed into a safe storage position on November 19, 2010. Entergy personnel subsequently resumed dry cask operation stack up and transfer on December 13, 2010 and the MPC was able to be loaded into the HI-STORM that day. The HI-STORM was subsequently placed on the independent spent fuel storage installation (lSFSl) pad on December 16, 2010, and no additional problems were encountered.
 
The inspectors reviewed Entergy actions and decision making to verify decisions were consistent with a conservative approach to assessing and addressing the condition.
 
The inspectors reviewed whether Entergy evaluations (and/or vendor supplied correspondence)were supported and addressed the structural performance of the MPC.The inspectors also reviewed station evaluations that concluded there was no structural damage to the mating device. The inspectors determined that Entergy and vendor-supplied evaluations appropriately concluded that the MPC was not adversely impacted in either thermal or structural performance.
 
Entergy entered the issue into the CAP and plans to revise Holtec procedure 2-DCS-009-GEN, "MPC Transfer & HI-STORM Movement," to ensure that the HI-TRAC is properly aligned with the mating device before the next cask is loaded.Specific documents reviewed during this inspection are listed in the attachment.
 
These activities constitute completion of one event follow-up sample as defined in NRC Inspection Procedure 7 1 1 53.Findinqs No findings were identified.
 
52
{{a|4OA5}}
==4OA5 Other Activities==
 
===.1 Confirmatorv===
 
Order. EA-09-060.
 
November 10. 2009. Failure to Provide Complete and Accurate lnformation Inspection Scope On May 22, 2008, the NRC completed a security baseline inspection at the Palisades Nuclear Plant. The inspection covered one or more of the key attributes of the security cornerstone of the NRC's Reactor Oversight Process. As a result of the inspection observations, the NRC Office of Investigations (Ol) initiated an investigation (Ol Case No. 3-2008-020).
 
Based on the evidence developed during the inspection and investigation, the NRC identified a violation of 10 CFR 50.9 for inaccurate and incomplete information.
 
Specifically, the licensee failed to ensure that information in corrective action documents was complete and accurate in all material respects and failed to provide accurate information to the Commission during a telephone conversation between a licensee employee and an NRC inspector.
 
The results of the investigation were sent to Entergy in a letter dated July 14,2009. This letter offered Entergy the opportunity to either participate in Alternate Dispute Resolution (ADR) mediation or to attend a Predecisional Enforcement Conference.
 
On July 28, 2009, the NRC and Entergy agreed to participate in ADR mediation.
 
On September 15, 2009, the NRC and Entergy participated in an ADR session and, as a result, a Confirmatory Order was issued pursuant to the agreement reached during the ADR process. As part of the ADR settlement agreement, Entergy agreed to a number of organizational, procedural, and management oversight related corrective actions and enhancements at Palisades Nuclear Plant and other Entergy Fleet nuclear sites.During this inspection at Indian Point Energy Center, from November 15 - 19, 2010, the inspectors evaluated the overall effectiveness of the licensee's response to Action ltem 2 of the Confirmatory Order. Specifically, Entergy developed and implemented a formal process, within the current CAP, that ensured that Safeguards and Security-Related information, which would othenrvise not be contained in the CAP, is processed in an auditable manner, consistent with Entergy's existing CAP.The evaluation was conducted through: 1) interviews with non-supervisory personnel at Indian Point Energy Center; 2) interviews with program managers and supervisors responsible for implementing the CAP at the site; and 3) an evaluation of licensee documents and procedures related to compliance with Action ltem 2 of the Confirmatory Order.The inspectors conducted the following specific inspection activities to:. Verify CRs that require documentation of Safeguards Information (SGl) were clearly identified as Safeguards CRs;o Verify where SGI is required to describe the condition or corrective actions, the additional information is contained in a uniquely identified and referenced safeguards document: Enclosure b.a..2 53 r Verify that CRs that require documentation of SGI reference the uniquely identified safeguards document and the uniquely identified safeguards document references the CR;. Verify the site security manager identified situations where SGI may need to be discussed for the Condition Review Group (CRG) and Corrective Action Review Board (CARB)to properly prioritize CRs or review CR evaluations, and that members of the CRG and CARB were qualified to review SGI;. Verify that review of the adequacy of the response to a corrective action was performed by safeguards qualified personnelwhen SGI was required to describe information in the Corrective Action (CA); and. Verify that closure reviews for safeguards CRs were performed by safeguards qualified personnel.
 
Findinqs No findings were identified.
 
Independent Spent Fuel Storaqe Installation Monitorinq Controls (60855)Inspection Scope The inspector reviewed routine operations and monitoring of the lSFSl. The inspector walked down the lSFSl, observed the condition of the storage modules including the air cooling ventilation openings, performed independent dose rate measurements of the storage modules, and reviewed logs that confirmed daily walkdowns were performed to observe ventilation openings for the months of August through November 2010 as specified in NRC Certificate of Compliance no. 1014 requirements.
 
Findinqs No findings were identified.
 
Review of the Shift Staffino Requirements Inspection Scope lnspectors reviewed the circumstances surrounding the February 9, 2010 occurrence where the Control Room Supervisor (CRS), assigned as having the control roorn command function, left the control room without designating another senior reactor operator qualified individual to assume the control room command function.Findinqs Command Function SLO Leaves the Control Room lntroduction.
 
A Green self-revealing NCV of TS 5.1, "Responsibility," was identified because on February 9,2010, the CRS assigned as having the control room command function, left the control room without designating another SRO-qualified individual to assume the control room command function.b..3 Enclosure 54
 
=====Description.=====
On February 9,2010, the CRS, one of two SRO-qualified individuals in the watch section, left the control room to lead the morning meeting. The Shift Supervisor (SS) was already out of the control room and the CRS had the responsibility for the control room command function at that time. This left the reactor operators with no senior reactor operator in the control room to respond to events.The Reactor Operator (RO) promptly recognized that there was no SRO in the control room and initiated actions to have the CRS return to the control. Upon hearing the RO paging him, the CRS realized his mistake and returned to the control room. The CRS was out of the control room for approximately 5 minutes. Technical Specification 5.1,"Responsibility," states that the SS shall be responsible for the control room command function and that during any absence of the SS from the control room while the unit is in MODE 1, 2,3, ot 4, an individual with an active Senior Reactor Operator (SRO) license shall be designated to assume the control room command function.
 
Entergy entered this issue into the CAP as CR-lP2-2010-00708.
 
Analvsis.
 
The performance deficiency associated with this finding was that the CRS left the control room without designating an SRO-qualified individual to assume the control room command function, contrary to the requirements of TS 5.1. His actions were also contrary to requirements of Entergy Nuclear Management Manual Procedure EN-OP-1 15, "Conduct of Operations." This finding is more than minor because it could reasonably be viewed as a precursor to a significant event. Specifically, the absence of SRO oversight during licensed control room activities increases the likelihood of human performance errors contributing to an initiating event and reduces the effectiveness of event mitigation.
 
The finding is associated with the human performance attribute of the Mitigating Systems cornerstone and affects the cornerstone objective of ensuring the availability, reliability and capability of systems that respond to initiating events to prevent undesirable consequences.
 
The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.
 
Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green) because of the short period the CRS was absent from the control room, and because no initiating events occurred during that time.The finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute because of the ineffective use of shift turnover practices, in that the CRS did not self check or communicate his decision to leave the control room to the rest of the control room staff. [H.a(a) per IMC 0310]Enforcement.
 
Technical Specification 5.1, "Responsibility," states that the SS shall be responsible for the control room command function and that during any absence of the SS from the control room while the unit is in MODE 1, 2,3, or 4, an individual with an active Senior Reactor Operator (SRO) license shall be designated to assume the control room command function.Contrary to the above, on February 9,2010, while the unit was in MODE 1, the Unit 2 CRS left the control room for a period of approximately five minutes without designating an individualwith an active SRO license to assume the control room command function.Because this TS noncompliance is of very low safety significance (Green) and was Enclosure 55 entered into the CAP as CR-lP2-2010-00708, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as an NCV: NCV 0500024712010005-09, Failure to Meet TS Oversight Requirement.
 
4OAO Meetinqs.
 
Includinq Exit On December 2,2Q10, the inspector presented inspection results of the radiation safety baseline inspection to Mr. Donald Mayer and other members of Entergy staff. The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.
 
No proprietary information was identified.
 
On December 9, 2010, the inspector presented the inspection results of the licensed operator requalification to members of licensee management.
 
The licensee acknowledged the issues presented.
 
The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.
 
No proprietary information was identified.
 
On January 10,2011, the inspector presented the results of the Selected lssue Follow-up Inspection of quality assurance and quality control issues to Mr. F. lnzirillo, Manager, Quality Assurance, and other members of the licensee staff. The licensee acknowledged the issues presented.
 
The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.
 
No proprietary information was identified.
 
On January 19,2Q11, the inspectors presented the inspection results of the integrated inspection to Mr. Joseph Pollock, Site Vice President, and other members of the Entergy staff. The licensee acknowledged the findings and observations presented.
 
The inspectors asked whether any materials examined during the inspection should be considered proprietary.
 
No proprietary information was identified.
 
4C.A7 Licensee-ldentified Violations The following violations of very low safety significance (Green) were identified by Entergy and are violations of NRC requirements which meet the criteria of the NRC Enforcement Policy, for being dispositioned as NCVs.o 1O CFR 50.47(bX4), requires that a standard emergency classification and action level scheme, the bases of which include facility system and effluent parameters, is in use by the licensee.
 
10 CFR 50.54(q), states in part, that licensees shall follow and maintain in effect emergency plans which meet the standards in 50.47(b).
 
Contrary to the above, on October 2Q,2010, during an extent of condition review of industry operating experience, Entergy personnel identified that the R-54 radiation monitor's (monitor is for liquid effluent from the waste distillate storage tanks) highest range of 4.7e-2 uCi/cc was below the value of 2.5e-1uCi/cc required to declare an Alert using emergency action level (EAL)Table 5.1.Entergy personnel documented this issue in the CAP as CR-IP2-20'10-06417 and provided timely guidance to the control room operators to ensure proper classification of an event. In addition, Entergy personnel performed an apparent cause evaluation which included an extent of condition of the issue. The EAL Enclosure 56 chart and associated emergency plan procedures were revised to reflect the EAL changes. The inspectors determined that this finding is of very low safety significance because it did not result in a significant degradation of the risk significant planning standard function.o 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," requires, in part, that the licensee establish a quality assurance program which complies with Appendix B. This program shall be documented by written policies, procedures, or instructions and shall be carried out throughout plant life in accordance with those policies, procedures, or instructions.
 
Procedure EN-QV-111, 'Training and Certification of InspectionA/erification and Examination Personnel," Section 4.0[4](i), requires that the Entergy corporate ANSI Level lll inspector shall perform periodic (annual) surveillances of quality control inspection activities to ensure that the program is being adequately implemented and maintained.
 
Contrary to the above, no surveillances of quality control inspection activities were performed for any Entergy site during calendar year 20Q8.The issue was not suitable for quantitative significance determination, so it was assessed using IMC 0609, Appendix M, and evaluated using the qualitative criteria listed in Table 4.1. This finding was determined to be of very low safety significance because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist. This issue was entered into the Entergy's CAP as CR-HQN-2009-00111.
 
ATTACHMENT:
 
=SUPPLEMENTAL
INFORMATION=
 
==KEY POINTS OF CONTACT==
Site Vice President Echelon Chief Engineer NDE Level lll, Code Programs Specialist - Nuclear Safety/License
lV Supervisor - Engineering
Shift Manager Echelon Manager - Fleet Operations
Specialist - Nuclear Safety/License
lV Manager - System Engineering
Manager - Dry Cask Project Project Manager - NUC Specialist - Nuclear Safety/License
lV Engineer lll- Nuclear Assistant
Plant Manager Shift Manager Echelon General Manager - Plant Operations, Fleet Operations
Support Shift Manager Manager - Operations
Echelon Senior Manager - Nuclear Safety and Licensing Maintenance
Inspection
Coordinator
Manager - Security Echelon Manager - Quality Assurance Supervisor - Radiation
Protection
Manager - IPEC Quality Assurance Echelon Senior Vice President - Planning, Development
and Oversight Lead Engineer - Buried Pipe and Tank Program Superintendent - l&C Senior Lead Engineer Specialist - Senior HP/Chemical
Manager - Design Engineering
White Plains Vice President - Nuclear Safety, Emergency
Preparedness, and Licensing Echelon Senior Staff Engineer Director * Engineering
Echelon Vice President - Oversight Shift Manager Specialist - Nuclear Safety/License
lV Specialist - Corrective
Action Superintendent - Simulator Superintendent - Dry Fuel Storage Specialist - Senior HP/Chemical
Senior Reactor Operator Superintendent - Licensed Operator Requal Training Technical
Specialist
lV Echelon Director - Oversight Attachment
M. Tesoriero A. Vitale R. Walpole E. Weinkam A. Williams Open and Closed 0500024712010-005-01
0500024712010-005-02
FIN 05000247t2010-005-03
FrN 0500024712010-005-04
05000247 /2010-005-05
NCV NCV 0500024712010-005-06
0500024712010-005-07
NCV 0500024712010-005-08
Ncv 0500024712010-005-09
Closed 0500024712010-007-00
NCV A-2 Manager * Programs and Components
General Manager - Plant Operations
Manager - Licensing White Plains Senior Manager - Nuclear Safety and Licensing Manager - PS&O  
==LIST OF ITEMS OPENED, CLOSED, AND DISCUSSED==
==LIST OF ITEMS OPENED, CLOSED, AND DISCUSSED==
NCVFINInadequate Compensatory Measures for Outof-Service Plant Vent Process Radiation Monitor(Section 1R19)Inadequate Work Planning Control Relative toRegenerative Heat Exchanger PermanentShielding Modification That Resulted in AdditionalUnplanned Collective Exposure (Section 2RS2)Inadequate Work Coordination Relative to ReactorCavity Liner Repair That Resulted in AdditionalUnplanned Collective Exposure (Section 2RS2)Failure to Perform Required Quality Controllnspections (Section 4C.A2)Failure to lmplement the Experience andQualification Requirements of the QualityAssurance Program (Section 4OA2)Inadequate Main Boiler Feed Pump SpeedController Setting (Section 4OA3)Failure to Staff the Site TSC and OSC Within 60Minutes of an Alert Emergency Declaration(Section 4OA3)Failure of Offsite Notification Procedure to Meetthe Requirements of the Site Emergency PlanSection 4OA3)Failure to Meet TS Oversight Requirement(Section 4OA5)LER Automatic Reactor Trip Due to a Turbine Trip as aResult of a High Steam Generator Level Trip AfterTransition to Single Feedwater Pump Operation(Section 4OA3)Attachment
NCV FIN Inadequate
A-3Refueling Cavity Leakage into Containment(Section 4OA2)05000247t2010-002-02 uRl
Compensatory
==LIST OF DOCUMENTS REVIEWED==
Measures for Outof-Service Plant Vent Process Radiation
Common Documents UsedIndian Point Unit 2 Updated Final Safety Analysis ReportIndian Point Unit 2 Individual Plant ExaminationIndian Point Unit 2 Individual Plant Examination of External EventsIndian Point Unit 2Technical Specifications and BasesIndian Point Unit 2 Technical Requirements ManualIndian Point Unit 2 Control Room Narrative LogsIndian Point Unit 2 Plan of the Day
Monitor (Section 1R19)Inadequate
Work Planning Control Relative to Regenerative
Heat Exchanger
Permanent Shielding
Modification
That Resulted in Additional
Unplanned
Collective
Exposure (Section 2RS2)Inadequate
Work Coordination
Relative to Reactor Cavity Liner Repair That Resulted in Additional
Unplanned
Collective
Exposure (Section 2RS2)Failure to Perform Required Quality Control lnspections (Section 4C.A2)Failure to lmplement
the Experience
and Qualification
Requirements
of the Quality Assurance
Program (Section 4OA2)Inadequate
Main Boiler Feed Pump Speed Controller
Setting (Section 4OA3)Failure to Staff the Site TSC and OSC Within 60 Minutes of an Alert Emergency
Declaration (Section 4OA3)Failure of Offsite Notification
Procedure
to Meet the Requirements
of the Site Emergency
Plan Section 4OA3)Failure to Meet TS Oversight
Requirement (Section 4OA5)LER Automatic
Reactor Trip Due to a Turbine Trip as a Result of a High Steam Generator
Level Trip After Transition
to Single Feedwater
Pump Operation (Section 4OA3)Attachment
Refueling
Cavity Leakage into Containment (Section 4OA2)05000247t2010-002-02
uRl  
==LIST OF DOCUMENTS==
REVIEWED Common Documents Used Indian Point Unit 2 Updated Final Safety Analysis Report Indian Point Unit 2 Individual Plant Examination Indian Point Unit 2 Individual Plant Examination of External Events Indian Point Unit 2Technical Specifications and Bases Indian Point Unit 2 Technical Requirements Manual Indian Point Unit 2 Control Room Narrative Logs Indian Point Unit 2 Plan of the Day
 
==Section 1R01: Adverse Eleather Protection==
 
===Procedures===
: 2-AOP-FLOOD-1, Flooding, Rev. 6
: IP-SMM, Event Notification and Reporting, Rev. 11
: OAP-008, Severe Weather Preparations, Rev. 7 Condition Reports (CR-lP2-)2010-07288
===Miscellaneous===
lP-RPT-04-00230, Indian Point Unit 2 Probabilistic Safety Assessment, Rev.Operator Control Room Logs, December 1 ,2010
 
==Section 1R04: Equipment==
: Alisnment Procedures
: 2-COL-4.1.1, Component Cooling System, Rev. 24 2-COL-27.3.1, Diesel Generators, Rev. 25 2-COL-27.6, Unit2 Appendix R Diesel Generator, Rev. 00 Condition Reports (CR-lP2-)2010-06246
: 2010-06268
: 2010-06534
: Drawinqs D253798, Emergency Diesel Generator Starting Air to Diesel #22, Rev. 3 D253801, Emergency Diesel Generator Lube Oil to Diesel #22, Rev. 5 D253804, Emergency Diesel Generator Jacket Water to Diesel #22, Rev. 6
 
==Section 1R05: Fire Protection==
 
===Procedures===
: EN-DC-161, Control of Combustibles, Rev. 4 lP2-RPT-03-00015, lP2 Fire Hazards Analysis, Rev. 2 Attachment 
===Condition Reports===
(CR-lP2-)201 0-06830 Pre Fire Plan
: PFP-216, General Floor Plan - Fan House -72'0",80'0", 88'0" and 90'0" Elevations, Rev. 0
: PFP-252A, Battery Rooms - Control Building - 33'0" Elevation, Rev. 0
: PFP-260, Chemical Additive Room - Auxiliary Feedwater Building - 32'6" Elevation, Rev. 0
: PFP-261, Auxiliary Feedwater Building - 43'0" and 53'0" Elevations, Rev. 0
: PFP-262, Auxiliary Feedwater Building - 64'0' and77'0" Elevations, Rev.0


==Section 1R01: Adverse Eleather ProtectionProcedures2-AOP-FLOOD-1, Flooding, Rev. 6IP-SMM, Event Notification and Reporting, Rev. 11OAP-008, Severe Weather Preparations, Rev. 7Condition Reports (CR-lP2-)2010-07288MiscellaneouslP-RPT-04-00230, Indian Point Unit 2 Probabilistic Safety Assessment, Rev.Operator Control Room Logs, December 1 ,2010Section 1R04: Equipment AlisnmentProcedures2-COL-4.1.1, Component Cooling System, Rev. 242-COL-27.3.1, Diesel Generators, Rev. 252-COL-27.6, Unit2 Appendix R Diesel Generator, Rev. 00Condition Reports (CR-lP2-)2010-06246 2010-06268 2010-06534DrawinqsD253798, Emergency Diesel Generator Starting Air to Diesel #22, Rev. 3D253801, Emergency Diesel Generator Lube Oil to Diesel #22, Rev. 5D253804, Emergency Diesel Generator Jacket Water to Diesel #22, Rev. 6Section 1R05: Fire ProtectionProceduresEN-DC-161, Control of Combustibles, Rev. 4lP2-RPT-03-00015, lP2 Fire Hazards Analysis, Rev. 2Attachment==
==Section 1R06: Flood Protection==
: A-4Condition Reports (CR-lP2-)201 0-06830Pre Fire PlanPFP-216, General Floor Plan - Fan House -72'0",80'0", 88'0" and 90'0" Elevations, Rev. 0PFP-252A, Battery Rooms - Control Building - 33'0" Elevation, Rev. 0PFP-260, Chemical Additive Room - Auxiliary Feedwater Building - 32'6" Elevation, Rev. 0PFP-261, Auxiliary Feedwater Building - 43'0" and 53'0" Elevations, Rev. 0PFP-262, Auxiliary Feedwater Building - 64'0' and77'0" Elevations, Rev.0
: Measures Procedures
: 2-AOP-FLOOD-1, Flooding, Rev. 6
: OAP-008, Severe Weather Preparations, Rev. 7 Condition Reports (CR-l P2-)2010-06872
: 2010-07033
===Work Orders===
: 255970 Miscellaneous
===Design Basis Document===
for 480 Volt Electrical System, Rev. 1 lndividual Plant Examination for External Events for Indian Point Unit 2 lP-RPT-04-00230, lndian Point Unit 2 Probabilistic Safety Assessment, Rev. 1 Safety Evaluation Report - Susceptibility of Safety-Related Systems to Flooding From Failure of Non-Category
: I Systems, Indian Point Unit 2, August 21, 2001 System Health Report, 480 Volt, 2no Quarter 2010


==Section 1R06: Flood Protection MeasuresProcedures2-AOP-FLOOD-1, Flooding, Rev. 6OAP-008, Severe Weather Preparations, Rev. 7Condition Reports (CR-l P2-)2010-06872 2010-07033Work Orders255970MiscellaneousDesign Basis Document for 480 Volt Electrical System, Rev. 1lndividual Plant Examination for External Events for Indian Point Unit 2lP-RPT-04-00230, lndian Point Unit 2 Probabilistic Safety Assessment, Rev. 1Safety Evaluation Report - Susceptibility of Safety-Related Systems to Flooding From Failure ofNon-Category I Systems, Indian Point Unit 2, August 21, 2001System Health Report, 480 Volt, 2no Quarter 2010Section 1R07: Heat Sink PerformanceProceduresSEP-SW-001,==
==Section 1R07: Heat Sink Performance==
: NRC Generic Letter 89-13 Service Water Program, Rev. 3Condition Reports (CR-lP2-)2010-06245 2010-06247Work Orders52031271
: 52231423 52231424MiscellaneousGL 89-13, Service Water System Problems Affecting Safety-related Equipment


==Section 1Rl1: Licensed Operator Requalification ProoramProcedures2-AOP-INST-1, InstrumenVController Failures, Rev. 62-AOP-RSD-1, Rapid Shutdown, Rev. 32-AOP-SG-1, Steam Generator Tube Leak, Rev. 112-E-0, Reactor Trip or Safety Injection, Rev. 32-E-2, Faulted Steam Generator lsolation, Rev. 0Attachment==
===Procedures===
: 2-E-3, Steam Generator Tube Rupture, Rev. 12-POP-2.1, Operation at Greater Than 45o/o Power, Rev. 57Condition Reports (CR-lP2-)2008-05504 2010-06029 2010-06049 2010-06064 2010-06068MiscellaneousEN-TQ-201, Systematic Approach to Training Process, Rev. 13EN-TQ-202, Simulator Configuration Control, Rev. 7EN-TQ-114, Licensed Operator Requalification Training Program Description, Rev. 3EN-TQ-210, Conduct of Simulator Training, Rev. 3IPEC Simulator Evaluated Scenario, Lesson
: SEP-SW-001, NRC Generic Letter 89-13 Service Water Program, Rev. 3 Condition Reports (CR-lP2-)2010-06245
: LRQ-SES-35, Rev. 2LRQ Sample Plan for 2009 Comprehensive Written ExamLRQ Sample Plan for 2010 Annual Operating ExamOAP-032, Operations Training Program, Rev. 11Simulator Maintenance and TestinoO-TQ-SM-106, 2009 Core Performance Test, Rev 4DR 2010-0040, Reactor Trip Comparison to Simulator ResponseSimulator Steady State Test 14.03.03.01 ,2010 Steady State Operability Test, Rev 1Simulator Normal Operations Test 1 4.3.7 .2,2010 Reactor Startup, Rev 1Simulator Surveillance Test
: 2010-06247
: PT-M45, 2010 Containment Sump Pumps, Rev 1Simulator Malfunction Test 14.04 .07 .19.01 , 2010 Area Rad. Monitor Failure, Rev 0Simufator Malfunction Test 14.04.07.17.11,2010 RCS Flow Transmitter Failure, Rev 0Simulator Transient Test 1 4.3.9.13,2010 LOCA with Blackout, Rev 4Simulator Transient Test 14.3.9 .14,2010 Pzrr PORV Fails Open without High Head, Rev 4
===Work Orders===
: 52031271
: 52231423
: 52231424 Miscellaneous
: GL 89-13, Service Water System Problems Affecting Safety-related Equipment


==Section 1R12: Maintenance EffectivenessProceduresO-LUB-401-GEN, Lubrication of Plant Equipment, Rev. 82-E-3, Steam Generator Tube Rupture, Rev. 12-SOP-5.4.1, Vapor Containment Pressure Reliefs, Rev. 172-VLV-001-AOV, Fisher 10" Butterfly Valve Maintenance for==
==Section 1Rl1: Licensed Operator Requalification==
: PCV-1190, 1191 and 1192, Rev.2EN-DC-205, Maintenance Rule Monitoring, Rev. 2EN-MP-100, Critical Procurements, Rev. 8OAP-1 15, Operations Commitments and Policy Details, Rev. 1 1Completed Procedures2-PT-Q013-DS149,
: Prooram Procedures
: 2-AOP-INST-1, InstrumenVController Failures, Rev. 6 2-AOP-RSD-1, Rapid Shutdown, Rev. 3 2-AOP-SG-1, Steam Generator Tube Leak, Rev. 11 2-E-0, Reactor Trip or Safety Injection, Rev. 3 2-E-2, Faulted Steam Generator lsolation, Rev. 0 Attachment
: 2-E-3, Steam Generator Tube Rupture, Rev. 1 2-POP-2.1, Operation at Greater Than 45o/o Power, Rev. 57 Condition Reports (CR-lP2-)2008-05504
: 2010-06029
: 2010-06049
: 2010-06064
: 2010-06068
===Miscellaneous===
: EN-TQ-201, Systematic Approach to Training Process, Rev. 13
: EN-TQ-202, Simulator Configuration Control, Rev. 7
: EN-TQ-114, Licensed Operator Requalification Training Program Description, Rev. 3
: EN-TQ-210, Conduct of Simulator Training, Rev. 3 IPEC Simulator Evaluated Scenario, Lesson
: LRQ-SES-35, Rev. 2 LRQ Sample Plan for 2009 Comprehensive Written Exam LRQ Sample Plan for 2010 Annual Operating Exam
: OAP-032, Operations Training Program, Rev. 11 Simulator Maintenance and Testino O-TQ-SM-106, 2009 Core Performance Test, Rev 4
: DR 2010-0040, Reactor Trip Comparison to Simulator Response Simulator Steady State Test 14.03.03.01
,2010 Steady State Operability Test, Rev 1 Simulator Normal Operations Test 1 4.3.7 .2,2010 Reactor Startup, Rev 1 Simulator Surveillance Test
: PT-M45, 2010 Containment Sump Pumps, Rev 1 Simulator Malfunction Test 14.04 .07 .19.01 , 2010 Area Rad. Monitor Failure, Rev 0 Simufator Malfunction Test 14.04.07.17.11,2010
: RCS Flow Transmitter Failure, Rev 0 Simulator Transient Test 1 4.3.9.13,2010
: LOCA with Blackout, Rev 4 Simulator Transient Test 14.3.9 .14,2010 Pzrr PORV Fails Open without High Head, Rev 4
 
==Section 1R12: Maintenance==
: Effectiveness
===Procedures===
: O-LUB-401-GEN, Lubrication of Plant Equipment, Rev. 8 2-E-3, Steam Generator Tube Rupture, Rev. 1 2-SOP-5.4.1, Vapor Containment Pressure Reliefs, Rev. 17 2-VLV-001-AOV, Fisher 10" Butterfly Valve Maintenance for
: PCV-1190, 1191 and 1192, Rev.2
: EN-DC-205, Maintenance Rule Monitoring, Rev. 2
: EN-MP-100, Critical Procurements, Rev. 8
: OAP-1 15, Operations Commitments and Policy Details, Rev. 1 1 Completed 
===Procedures===
: 2-PT-Q013-DS149,
: PCV-1 1 90,
: PCV-1 1 90,
: PCV-1 191 ,
: PCV-1 191 ,
: PCV-1 192,
: PCV-1 192,
: SOV-1 279, and
: SOV-1 279, and
: SOV-1280 IST DataSheet, Rev.26Condition Reports (CR-lP2-)2006-04723 2006-06322 2008-04145 2010-03795 2010-03829 2010-038812010-04007 2Q10-04038 2010-04290 2010-04333 2010-04395 2010-044802o1o-04747 2010-04762 2010-04830 2010-04935 2010-05118 2010-054582010-05519 2010-05694 2010-05696 2010-05697 2010-06658 2001-10724Work Orders00164445 00239756002425Q1Attachment
: SOV-1280 IST Data Sheet, Rev.26 Condition Reports (CR-lP2-)2006-04723  
: A-6Drawinqs9321-F-2017, Flow Diagram - Main Steam, Rev. 84MiscellaneousCritical Procurement Plan for 21 Reactor Coolant Pump Motor Replacement in 2R19LO-CAR-2010-00081Maintenance Rule Basis Document Main Steam, Rev. 2Maintenance Rule Basis Document for Reactor Coolant System, Rev. 2Operational Decision Making Instruction for
: 2006-06322  
: RCP-21 Upper Oil Reservoir Elevated BearingTemperatures, June 29, 2010Reactor Coolant Pump 21 Upper Thrust Bearing Temperature Trend, June 23, 2010 *September 2,2010R&G Laboratories, Oil Analysis Severity for Reactor Coolant Pump 21, August 11,2010System Health Report - HVAC - Central Control Room, 2nd Quarter 2010
: 2008-04145  
: 2010-03795  
: 2010-03829  
: 2010-03881
: 2010-04007  
: 2Q10-04038  
: 2010-04290  
: 2010-04333  
: 2010-04395  
: 2010-04480
: 2o1o-04747  
: 2010-04762  
: 2010-04830  
: 2010-04935  
: 2010-05118  
: 2010-05458
: 2010-05519  
: 2010-05694  
: 2010-05696  
: 2010-05697  
: 2010-06658  
: 2001-10724
===Work Orders===
: 00164445
: 00239756 002425Q1 Attachment Drawinqs 9321-F-2017, Flow Diagram - Main Steam, Rev. 84 Miscellaneous Critical Procurement Plan for 21 Reactor Coolant Pump Motor Replacement in 2R19 LO-CAR-2010-00081
: Maintenance Rule Basis Document Main Steam, Rev. 2 Maintenance Rule Basis Document for Reactor Coolant System, Rev. 2 Operational Decision Making Instruction for
: RCP-21 Upper Oil Reservoir Elevated Bearing Temperatures, June 29, 2010 Reactor Coolant Pump 21 Upper Thrust Bearing Temperature Trend, June 23, 2010 *September  
: 2,2010 R&G Laboratories, Oil Analysis Severity for Reactor Coolant Pump 21, August 11,2010 System Health Report - HVAC - Central Control Room, 2nd Quarter 2010
 
==Section 1Rl3: Maintenance==
: Risk Assessments and Emerqent Work Control Procedures
: EN-WM-104, On Line Risk Assessment, Rev. 1 lP-SMM-101, Online Risk Assessment, Rev. 3
: OAP-008, Severe Weather Preparations, Rev. 6 Condition Reports (CR-lP2-)2010-Q6274
===Miscellaneous===
: Operator Narrative Logs, October 13, 2010 Operator Narrative Logs, October 14,201Q Operator Narrative Logs, November 4, 2010 Operator Narrative Logs, November 1 4,2010 Operator Narrative Logs, December 1 ,201Q Operator's Risk Report, October 13,2010 Operator's Risk Report, October 14,2010 Operator's Risk Report, November 4,2010 Operator's Risk Report, November 14,201Q Operator's Risk Report, December 1,2010
 
==Section 1Rl5: Operabilitv==
: Evaluations
===Procedures===
: 2-PT-V072.
: In-Service Test Relief Valve Tests, Rev. 2
: EN-OP-104, Operability Determination Process, Rev. 4
: EN-MA-133, Control of Scaffolding, Rev. 6 Condition Reports (CR-lP2-)2010-03667
: 2010-05501
: 2010-05505
: 2010-05669
: 2010-05670
: 2010-05671
: 2Q10-06248
: 2010-06267
: 2010-06423
===Work Orders===
: 244302
: 52256617 2010-05522
: 2010-05633
: 2010-05650
: 2010-05928
: 2010-05790
: 2010-05979
: 201 0-0661 9 Attachment Drawinqs 9321-F-2722, Flow Diagram - Service Water System, Rev. 125 Miscellaneoqg System Health Report - Service Water, 2no Quarter 2010
 
==Section 1Rl8: Plant Modifications==


==Section 1Rl3: Maintenance Risk Assessments and Emerqent Work ControlProceduresEN-WM-104, On Line Risk Assessment, Rev. 1lP-SMM-101, Online Risk Assessment, Rev. 3OAP-008, Severe Weather Preparations, Rev. 6Condition Reports (CR-lP2-)2010-Q6274MiscellaneousOperator Narrative Logs, October 13, 2010Operator Narrative Logs, October 14,201QOperator Narrative Logs, November 4, 2010Operator Narrative Logs, November 1 4,2010Operator Narrative Logs, December 1 ,201QOperator's Risk Report, October 13,2010Operator's Risk Report, October 14,2010Operator's Risk Report, November 4,2010Operator's Risk Report, November 14,201QOperator's Risk Report, December 1,2010Section 1Rl5: Operabilitv EvaluationsProcedures2-PT-V072. In-Service Test Relief Valve Tests, Rev. 2EN-OP-104, Operability Determination Process, Rev. 4EN-MA-133, Control of Scaffolding, Rev. 6Condition Reports (CR-lP2-)2010-03667 2010-05501 2010-055052010-05669 2010-05670 2010-056712Q10-06248 2010-06267 2010-06423Work Orders244302 522566172010-05522 2010-05633 2010-056502010-05928 2010-05790 2010-05979201==
===Procedures===
: 0-0661 9Attachment
: 2-ARP-003, Diesel Generator, Rev. 8 2-SOP-27.3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 23 2-TOP-016,22
: A-7Drawinqs9321-F-2722, Flow Diagram - Service Water System, Rev. 125MiscellaneoqgSystem Health Report - Service Water, 2no Quarter 2010
: Emergency Diesel Generator Performance Test, Rev. 0
: EN-DC-136, Temporary Modifications, Rev. 5 Condition Reports (CR-)1P2-2006-07329
: 1P2-2010-04711
tP2-2010-06260
lP3-2010-02924
===Work Orders===
: 247503
: 52268854 MiscellaneoUs
\P2-2UA-06052
tP2-2010-06246
lP-CALC-06-00329, Replacement of Emergency Diesel Generator Air Start Motors, Rev. 1 Standing Order 06-04, Emergency Diesel Generator Starting Air Pressure, December 27, 2006


==Section 1Rl8: Plant ModificationsProcedures2-ARP-003, Diesel Generator, Rev. 82-SOP-27.3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 232-TOP-016,22 Emergency Diesel Generator Performance Test, Rev. 0EN-DC-136, Temporary Modifications, Rev. 5Condition Reports (CR-)1P2-2006-07329 1P2-2010-04711tP2-2010-06260 lP3-2010-02924Work Orders247503 52268854MiscellaneoUs\P2-2UA-06052 tP2-2010-06246lP-CALC-06-00329, Replacement of Emergency Diesel Generator Air Start Motors, Rev. 1Standing Order 06-04, Emergency Diesel Generator Starting Air Pressure, December 27, 2006Section 1Rl9: Post-Maintenance TestinqProcedures2-PT-2Y008B,22 Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 42-PT-2Y045A,21 Service Water Pump Full Flow Test, Rev. 22-PT-M021B, Emergency Diesel Generator 22Load Test, Rev. 192-SOP-27 .3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 232-SOP-27.6, Unit 2 Appendix R Diesel Generator Operation, Rev. 6lP-EP-1 15, Emergency Plan Forms, Rev. 27lP-EP-AD4O, Equipment lmportant to Emergency Response, Rev. 5lP-EP-310, Dose Assessment, Rev. 10lP-RPT-07-00018, lP2 lnservice Test Program, Rev. 0IPEC Emergency Plan, Revision 09-01IPEC Unit 2 Technical Requirements ManuallP-EP-115, Emergency Plan Forms, Revision 27lP-EP-310, Dose Assessment, Revision 10lP-EP-AD4O, Equipment lmportant to Emergency Response, Revision 5Completed Procedures2-PC-EM29, Wide Range Gas Effluent Radiation Monitor==
==Section 1Rl9: Post-Maintenance==
: R-27 Transfer Calibration, Rev. 8,November 10,20102-PT-2Y0088.,22 Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 4,October 12,20102-PT-2Y043, Appendix R DG Rated Load Test, Rev. 0, October 8,20102-PT-2Y045A,21 Service Water Pump Full Flow Test, Rev. 2, October 27,20102-PT-MO21B, Emergency Diesel Generator 22 Load Test, Rev. 19, October 13, 201QWork Order 52215Q74,24 Service Water Pump 480V Breaker, October 29,201QAttachment  
: Testinq Procedures
: 2-PT-2Y008B,22  
: Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 4 2-PT-2Y045A,21  
: Service Water Pump Full Flow Test, Rev. 2 2-PT-M021B, Emergency Diesel Generator  
: 2Load Test, Rev. 19 2-SOP-27 .3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 23 2-SOP-27.6, Unit 2 Appendix R Diesel Generator Operation, Rev. 6 lP-EP-1 15, Emergency Plan Forms, Rev. 27 lP-EP-AD4O, Equipment lmportant to Emergency Response, Rev. 5lP-EP-310, Dose Assessment, Rev. 10lP-RPT-07-00018, lP2 lnservice Test Program, Rev. 0 IPEC Emergency Plan, Revision 09-01 IPEC Unit 2 Technical Requirements Manual lP-EP-115, Emergency Plan Forms, Revision 27 lP-EP-310, Dose Assessment, Revision 10 lP-EP-AD4O, Equipment lmportant to Emergency Response, Revision 5 Completed 
===Procedures===
: 2-PC-EM29, Wide Range Gas Effluent Radiation Monitor R-27 Transfer Calibration, Rev. 8, November 10,2010 2-PT-2Y0088.,22  
: Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 4, October 12,2010 2-PT-2Y043, Appendix R DG Rated Load Test, Rev. 0, October 8,2010 2-PT-2Y045A,21  
: Service Water Pump Full Flow Test, Rev. 2, October 27,2010 2-PT-MO21B, Emergency Diesel Generator Load Test, Rev. 19, October 13, 201Q Work Order 52215Q74,24  
: Service Water Pump 480V Breaker, October 29,201Q Attachment  
===Condition Reports===
===Condition Reports===
(CR-lP2-)2010-05621 2010-06052 2010-062092010-06685 2010-06696 2010-06716A-82010-06246 2010-06260 2010-064172010-Q6718 2010-06721 2010-06722Work Orders00202596 0024970352262112 5226869352215074 522468635227334452255456 52255457Drawinos9321-F-2722, Flow Diagram, Service Water System, Rev. 125D262583, Steam Generator Narrow Range Level -
(CR-lP2-)2010-05621  
: CH.2, Rev. 5MiscellaneousContingency Action for Determining a Release While R-27 is Out of Service for E-PlanPurposes (dated November 3, 2010)Interim Guidance for When Radiation Monitor R-27 is Out of Service for Declaring anEmergency Action Level (EAL) (dated November 24,2010)
: 2010-06052  
: 2010-06209
: 2010-06685  
: 2010-06696  
: 2010-06716
: 2010-06246  
: 2010-06260  
: 2010-06417
: 2010-Q6718  
: 2010-06721  
: 2010-06722
===Work Orders===
: 00202596
: 00249703
: 52262112
: 52268693
: 52215074
: 52246863
: 52273344
: 52255456
: 52255457 Drawinos 9321-F-2722, Flow Diagram, Service Water System, Rev. 125 D262583, Steam Generator Narrow Range Level -
: CH.2, Rev. 5 Miscellaneous Contingency Action for Determining
a Release While R-27 is Out of Service for E-Plan Purposes (dated November 3, 2010)Interim Guidance for When Radiation Monitor R-27 is Out of Service for Declaring an Emergency Action Level (EAL) (dated November 24,2010)
 
==Section 1R20: Refuelinq==
 
and Outaqe Activities Completed 
===Procedures===
: 2-PT-V53, Mode Change Checklist, Mode 3 to Mode 2, Rev. 7, November 22,2Q1Q lP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 18,2010 Procedures
: 2-POP^1.2, Reactor Startup, Rev. 55 2-POP-1.3, Plant Startup fromZeroTo
: 45o/o Power, Rev. 82 2-POP-2.1, Operation at Greater Than 45% Power, Rev. 57 2-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 54 2-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75
: EN-OM-123, Fatigue management Program, Rev. 3 Condition Reports (CR-lP2-)2010-06764
: 2010-06801
===Work Orders===
: 00255970
: 00256247 Miscellaneous EmpCenter Fatigue Management Software Outage Schedule for 21Main Transformer Replacement, November 9, 2010


==Section 1R20: Refuelinq and Outaqe ActivitiesCompleted Procedures2-PT-V53, Mode Change Checklist, Mode 3 to Mode 2, Rev. 7, November 22,2Q1QlP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 18,2010Procedures2-POP^1.2, Reactor Startup, Rev. 552-POP-1.3, Plant Startup fromZeroTo 45o/o Power, Rev. 822-POP-2.1, Operation at Greater Than 45% Power, Rev. 572-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 542-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75EN-OM-123, Fatigue management Program, Rev. 3Condition Reports (CR-lP2-)2010-06764 2010-06801Work Orders00255970 00256247MiscellaneousEmpCenter Fatigue Management SoftwareOutage Schedule for 21Main Transformer Replacement, November 9, 2010Section 1R22: Surveillance TestinqCompleted Procedures0-SOP-LEAKRATE-001,==
==Section 1R22: Surveillance==
: RCS Leakrate Surveillance, Evaluation and Leak ldentification, Rev. 1,December 4.20100-SOP-LEAKRATE-001, RCS LeakrateDecember 5, 20100-SOP-LEAKRATE-001, RCS LeakrateDecember 12,2010Surveillance, Evaluation and Leak ldentification, Rev. 1,Surveillance, Evaluation and Leak ldentification, Rev. 1,Attachment  
: Testinq Completed 
: 2-PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 7, September17,20082-PT-Q013, Inservice Valve Tests, Data Sheet 43, Rev. 45, October 19,20102-PT-Q017C, Alternate Safe Shutdown Supply Verification to 23 CCP, Rev. 1 1 , September 1,20102-PT-Q028A, 21 Residual Heat Removal Pump, Rev. 18, October 18,2010PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 6, May 22,2008Procedures2-OSP-4.1.2, Support Procedure - Component Cooling System Operation, Rev. 42-SOP-4.1.2, Component Cooling System Operation, Rev. 35Condition Reports (CR-lP2-)2008-02757 2010-05446 2010-05695 2010-05822DrawinqsA227968, D/C for Alternate Safe Shutdown System Source Range Monitor Hot and Cold LegResistance Temperature Detectors, Rev. 4
===Procedures===
: 0-SOP-LEAKRATE-001, RCS Leakrate Surveillance, Evaluation and Leak ldentification, Rev. 1, December 4.2010 0-SOP-LEAKRATE-001, RCS Leakrate December 5, 2010 0-SOP-LEAKRATE-001, RCS Leakrate December 12,2010 Surveillance, Evaluation and Leak ldentification, Rev. 1, Surveillance, Evaluation and Leak ldentification, Rev. 1, Attachment  
: 2-PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 7, September 17,2008 2-PT-Q013, Inservice Valve Tests, Data Sheet 43, Rev. 45, October 19,2010 2-PT-Q017C, Alternate Safe Shutdown Supply Verification to 23 CCP, Rev. 1 1 , September  
: 1, 2010 2-PT-Q028A, 21 Residual Heat Removal Pump, Rev. 18, October 18,2010
: PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 6, May 22,2008 Procedures
: 2-OSP-4.1.2, Support Procedure - Component Cooling System Operation, Rev. 4 2-SOP-4.1.2, Component Cooling System Operation, Rev. 35 Condition Reports (CR-lP2-)2008-02757  
: 2010-05446  
: 2010-05695  
: 2010-05822
: Drawinqs A227968, D/C for Alternate Safe Shutdown System Source Range Monitor Hot and Cold Leg Resistance Temperature Detectors, Rev. 4


==Section 1EP6: Drill EvaluationProcedures2-AOP-INST-1, InstrumenVController Failures, Rev. 62-AOP-RSD-1, Rapid Shutdown, Rev. 32-AOP-SG-1, Steam Generator Tube Leak, Rev. 1 12-E-0, Reactor Trip or Safety Injection, Rev. 32-E-2, Faulted Steam Generator lsolation, Rev. 02-E-3, Steam Generator Tube Rupture, Rev. 12-POP-2.1, Operation at Greater Than 45% Power, Rev. 57MiscellaneousIPEC Simulator Evaluated Scenario, Lesson==
==Section 1EP6: Drill Evaluation==
: LRQ-SES-3S, Rev. 2Sections 2RS1/2RS2: Radioloqical Hazard Assessment and ExposureControls/Occupational ALARA Planninq and GontrolsProceduresEN-RP-101, Access Control for Radiological Controlled Areas, Rev. 5EN-RP-105, RadiologicalWork Permits, Rev. 9EN-RP-110, ALARA Program, Rev. 7EN-RP-1 10-01. ALARA lnitiative DeferralsCondition Reports (CR-lP2)2010-1165 2010-1336 2010-1640 2010-19052010-1940 2010-2055 2010-2817 2010-28222010-3864 2010-4746 2010-61192010-1932 2010-19332010-2997 2010-3300Condition Reports (CR-l P3)tP3-2010-1995MiscellaneousQA-14115-2009-lP-1, Quality Assurance Audit of IPEC Radiation Protection and RadwasteAttachment
: A-10Section 4OA1 : Performance Indicator VerificationProceduresEN-LI-114, Performance Indicator Process, Rev. 4MiscellaneousBarrier Integrity Indicator Consolidated Data Entry Reports - Reactor Coolant System Leakage,October 2009 - September 2010Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Cooling WaterSupport, October 2009 - September 2010Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Heat Removal,October 2009 - September 2010Operator Narrative Logs, October 2009 - September 2010


==Section 4OA2: ldentification and Resolution of ProblemsProceduresEN-Ll-102, Corrective Action Process, Rev. 15EN-Ll-121, Entergy Trending Process, Rev. 8EN-MA-102, Inspection Program, Rev. 3 and 4EN-OP-115, Conduct of Operations, Rev. 9EN-QV-100, Conduct of Nuclear Oversight, Rev. 4EN-QV-109, Audit Process, Rev. 16EN-QV-109-02, Audit Process Guidance, Rev. 0EN-QV-1 1 1, Training and Certification of InspectionA/erification and Examination Personnel,Rev.8EN-QV-117, Oversight Training Program, Rev. 9EN-QV-119, Corrective Action Requests, Supplier Stop Work Orders, and Recommendations,Rev.6EN-QV'123, Supplier Audits/Surveys, Rev. 3EN-QV-128, Assessment of Nuclear Oversight, Rev. 2EN-QV-129, Vulnerability Review Process, Rev. 1OAP-O17, Plant Surveillance and Operator Rounds, Rev. 6OAP-046, Operator Burden Program, Rev. 1Technical SpecificationsWaterford Unit 3, 6.3 Unit Staff QualificationsArkansas Nuclear One -1, 5.3 Unit Staff QualificationsArkansas Nuclear One -2,6.3 Unit Staff QualificationsGrand Gulf, 5.3 Unit Staff QualificationsIndian Point 2, 5.3 Unit Staff QualificationsIndian Point 3, 5,3 Unit Staff QualificationsRiver Bend, 5.3 Plant Staff QualificationsVermont Yankee, 5.3 Plant Staff QualificationsJames A. Fitzpatrick, 5.3 Unit Staff QualificationsPalisades Nuclear Plant, 5.3 Unit Staff QualificationsPilgrim Nuclear Power Station, 6.2 Unit Staff QualificationsCondition Reports (CR-)ANO-1-2009-02330ANO-C-2009-01884ANO-2010-01503ANO-1 -201Q-01724ANO-1 -2010-00743ANO-1-2010-01080Attachment==
===Procedures===
: ANO-C-2009-02608ANO-2-2010-00028JAF-2010-03280HQN-2010-00415HQN-2010-00333HQN-2010-00123HQN-2010-00109HQN-2010-00068HQN-2010-00063HQN-2010-00045HON-2010-00060HQN-2009-01198HQN-2009-01194HQN-2010-00594HQN-2009-01171HQN-2009-01153rP2-2009-05393tP2-2009-05399tP2-2009-05400rP2-2009-05389rP2-2009-05349rP2-2009-05348tP2-2009-A$21tP2-2010-04215tP2-2010-04524tP2-2010-05163PLP-2009-05909PLP-2010-02012PLP-2009-05908PNP-2009-05303PNP-2009-05297PNP-2010-02124RBS-2010-01472RBS-2010-02033RBS-2010-00200RBS-2010-0Q221RBS-2010-00278RBS-2010-00088RBS-2010-00011RBS-2009-06520RBS-2009-06539wF3-2010-00284wF3-2009-07713wY-2009-04496wY-2010-01479wY-2010-02759cGS-2009-06921GGS-2009-06922cGS-2009-06923GGS-2009-06927GGS-2009-06806GGN-2010-00164A-11ANO-1-2010-01182JAF-2008-03648HQN-2010-00111HQN-2009-00178HQN-2009-01083HQN-2009-01084HQN-2009-01085HQN-2009-01091HQN-2009-01093HQN-2009-01096HQN-2009-01140HQN-2009-01150HQN-2009-01169HQN-2009-01170HQN-2009-01184tP2-2010-04085lP3-2010-01740tP2-2010-03985tP2-2010-03986tP2-2010-03988lP2-2010-03984tP3-2009-04903tP3-2009-04905tP2-2010-04396tP2-2010-04547PLP-2009-04108PLP-2009-05613PLP-2009-05918PNP-2009-01798PNP-2009-02059PNP-2009-02255PNP-2008-00916RBS-2010-00006RBS-2009-06472RBS-2009-06495RBS-2009-06456RBS-2009-06450RBS-2009-06452R85-2009-06158RBS-2009-06209RBS-2009-06449wF3-2009-07711wF3-2010-02629wY-2010-04432wY-2010-04434GGN-2010-04140GGN-2010-02730GGN-2010-04178GGN-2010-04101GGN-2010-04092GGN-2010-03674GGN-2010-03721ANO-1-2010-00719JAF-2009-04592HQN-2009-01188HQN-2009-01197HQN-2010-00013HQN-2010-00386HQN-2010-00571HQN-2010-00593HQN-2010-00515HQN-2010-00550HQN-2010-00511HQN-2010-00510HQN-2010-00475HQN-2010-00499HQN-2010-00338tP3-2009-04917rP3-2009-04920tP3-2009-04897tP2-2009-05404rP2-2009-05409lP3-2009-04868rP3-2009-04883tP3-2009-04884tP2-2010-04457tP2-2010-04864PLP-2010-02288PLP-2010-02290PLP-2009-05942PNP-2008-03922PNP-2009-05359PNP-2010-00015RBS-2008-04685RBS-2009-05041RBS-2009-06123RBS-2009-06446RBS-2009-06451RBS-2009-06471RBS-2009-06473RBS-2009-06490RBS-2010-00044wF3-2010-01198wF3-2010-01356wF3-2010-00746wY-2010-04496wY-2010-00070GGN-2010-02135GGN-2010-02382GGN-2010-02902GGN-2010-00590GGN-2010-01247GGN-2010-Q1252GGN-2009-06575Attachment
: 2-AOP-INST-1, InstrumenVController Failures, Rev. 6 2-AOP-RSD-1, Rapid Shutdown, Rev. 3 2-AOP-SG-1, Steam Generator Tube Leak, Rev. 1 1 2-E-0, Reactor Trip or Safety Injection, Rev. 3 2-E-2, Faulted Steam Generator lsolation, Rev. 0 2-E-3, Steam Generator Tube Rupture, Rev. 1 2-POP-2.1, Operation at Greater Than 45% Power, Rev. 57 Miscellaneous
: GGN-2009-06904GGN-2009-06910GGN-2009-06505ANO-2010-01503MiscellaneousEntergy Quarterly Trend Report, 2no Quarter 2010Maintenance Rule (aX1) Systems List since December 2009Operator Burdens Performance Indicator, November 2009 - October 2010Operator Special Log Index, September 2010 - December 2010Operator Work Arounds Performance Indicator, November 2009 - October 2010EOI Letter,
: IPEC Simulator Evaluated Scenario, Lesson
: ENOC-10-00002, Response to Request for lnformation, Rev. 1, January 8,2010EOI Letter,
: LRQ-SES-3S, Rev. 2 Sections 2RS1/2RS2:
: ENOC-09-00037, Response to Request for Information, November 30, 2010QAPM, Entergy Quality Assurance Program Manual, Rev. 0 through 20Regulatory Guide 1.8, Personnel Selection and Training, Rev. 1ANSI/ANS 3.1-1978, American National Standard for Selection and Training of Nuclear PowerPlant Personnel, 1978ANSI N18.1-1971, American National Standard for Selection and Training of Nuclear PowerPlant Personnel, 1971NRC SER, NRC Safety Evaluation Report, "Entergy Operations, Inc. Quality AssuranceProgram Consolidation," November 6, 1998Technical Specification, Unit Staff Qualifications, Various5.3.1, Personnel Change Planning ChecklisVForms for QA Manager Candidates, July 2007CEO2009-00195, Corporate ANSI Level lll Surveillance of W Maintenance Inspection Program(VfY), December 15,2009EOI Letter,
: Radioloqical Hazard Assessment and Exposure Controls/Occupational
: BVY 03-12, Vermont Yankee Nuclear Power Station, Docket No. 50-271, AnnualSubmittal of QAP Changes (WY), February 5, 2003CIN-2003/00059, Vermont Yankee, 10 CFR Part 50.54(a)(3) Change Review, April 24,2002EOI Letter No.,
: ALARA Planninq and Gontrols Procedures
: EN-RP-101, Access Control for Radiological Controlled Areas, Rev. 5
: EN-RP-105, RadiologicalWork Permits, Rev. 9
: EN-RP-110, ALARA Program, Rev. 7
: EN-RP-1 10-01. ALARA lnitiative Deferrals Condition Reports (CR-lP2)2010-1165
: 2010-1336
: 2010-1640
: 2010-1905 2010-1940
: 2010-2055
: 2010-2817
: 2010-2822 2010-3864
: 2010-4746
: 2010-6119 2010-1932
: 2010-1933 2010-2997
: 2010-3300 Condition Reports (CR-l P3)tP3-2010-1995
===Miscellaneous===
: QA-14115-2009-lP-1, Quality Assurance Audit of IPEC Radiation Protection and Radwaste Attachment Section 4OA1 : Performance Indicator Verification
===Procedures===
: EN-LI-114, Performance Indicator Process, Rev. 4 Miscellaneous Barrier Integrity Indicator Consolidated Data Entry Reports - Reactor Coolant System Leakage, October 2009 - September
: 2010 Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Cooling Water Support, October 2009 - September
: 2010 Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Heat Removal, October 2009 - September
: 2010 Operator Narrative Logs, October 2009 - September
: 2010
 
==Section 4OA2: ldentification==
 
and Resolution of Problems Procedures
: EN-Ll-102, Corrective Action Process, Rev. 15
: EN-Ll-121, Entergy Trending Process, Rev. 8
: EN-MA-102, Inspection Program, Rev. 3 and 4
: EN-OP-115, Conduct of Operations, Rev. 9
: EN-QV-100, Conduct of Nuclear Oversight, Rev. 4
: EN-QV-109, Audit Process, Rev. 16
: EN-QV-109-02, Audit Process Guidance, Rev. 0
: EN-QV-1 1 1, Training and Certification of InspectionA/erification and Examination Personnel, Rev.8
: EN-QV-117, Oversight Training Program, Rev. 9
: EN-QV-119, Corrective Action Requests, Supplier Stop Work Orders, and Recommendations, Rev.6
: EN-QV'123, Supplier Audits/Surveys, Rev. 3
: EN-QV-128, Assessment of Nuclear Oversight, Rev. 2
: EN-QV-129, Vulnerability Review Process, Rev. 1
: OAP-O17, Plant Surveillance and Operator Rounds, Rev. 6
: OAP-046, Operator Burden Program, Rev. 1 Technical Specifications Waterford Unit 3, 6.3 Unit Staff Qualifications Arkansas Nuclear One -1, 5.3 Unit Staff Qualifications Arkansas Nuclear One -2,6.3 Unit Staff Qualifications Grand Gulf, 5.3 Unit Staff Qualifications Indian Point 2, 5.3 Unit Staff Qualifications Indian Point 3, 5,3 Unit Staff Qualifications River Bend, 5.3 Plant Staff Qualifications Vermont Yankee, 5.3 Plant Staff Qualifications James A. Fitzpatrick, 5.3 Unit Staff Qualifications Palisades Nuclear Plant, 5.3 Unit Staff Qualifications Pilgrim Nuclear Power Station, 6.2 Unit Staff Qualifications
===Condition Reports===
(CR-)ANO-1-2009-02330
: ANO-C-2009-01884
: ANO-2010-01503
: ANO-1 -201Q-01724
: ANO-1 -2010-00743
: ANO-1-2010-01080
: ANO-C-2009-02608
: ANO-2-2010-00028
: JAF-2010-03280
: HQN-2010-00415
: HQN-2010-00333
: HQN-2010-00123
: HQN-2010-00109
: HQN-2010-00068
: HQN-2010-00063
: HQN-2010-00045
: HON-2010-00060
: HQN-2009-01198
: HQN-2009-01194
: HQN-2010-00594
: HQN-2009-01171
: HQN-2009-01153
rP2-2009-05393
tP2-2009-05399
tP2-2009-05400
rP2-2009-05389
rP2-2009-05349
rP2-2009-05348
tP2-2009-A$21
tP2-2010-04215
tP2-2010-04524
tP2-2010-05163
: PLP-2009-05909
: PLP-2010-02012
: PLP-2009-05908
: PNP-2009-05303
: PNP-2009-05297
: PNP-2010-02124
: RBS-2010-01472
: RBS-2010-02033
: RBS-2010-00200
: RBS-2010-0Q221
: RBS-2010-00278
: RBS-2010-00088
: RBS-2010-00011
: RBS-2009-06520
: RBS-2009-06539
wF3-2010-00284
wF3-2009-07713
wY-2009-04496
wY-2010-01479
wY-2010-02759
cGS-2009-06921
: GGS-2009-06922
cGS-2009-06923
: GGS-2009-06927
: GGS-2009-06806
: GGN-2010-00164
: ANO-1-2010-01182
: JAF-2008-03648
: HQN-2010-00111
: HQN-2009-00178
: HQN-2009-01083
: HQN-2009-01084
: HQN-2009-01085
: HQN-2009-01091
: HQN-2009-01093
: HQN-2009-01096
: HQN-2009-01140
: HQN-2009-01150
: HQN-2009-01169
: HQN-2009-01170
: HQN-2009-01184
tP2-2010-04085
lP3-2010-01740
tP2-2010-03985
tP2-2010-03986
tP2-2010-03988
lP2-2010-03984
tP3-2009-04903
tP3-2009-04905
tP2-2010-04396
tP2-2010-04547
: PLP-2009-04108
: PLP-2009-05613
: PLP-2009-05918
: PNP-2009-01798
: PNP-2009-02059
: PNP-2009-02255
: PNP-2008-00916
: RBS-2010-00006
: RBS-2009-06472
: RBS-2009-06495
: RBS-2009-06456
: RBS-2009-06450
: RBS-2009-06452
: R85-2009-06158
: RBS-2009-06209
: RBS-2009-06449
wF3-2009-07711
wF3-2010-02629
wY-2010-04432
wY-2010-04434
: GGN-2010-04140
: GGN-2010-02730
: GGN-2010-04178
: GGN-2010-04101
: GGN-2010-04092
: GGN-2010-03674
: GGN-2010-03721
: ANO-1-2010-00719
: JAF-2009-04592
: HQN-2009-01188
: HQN-2009-01197
: HQN-2010-00013
: HQN-2010-00386
: HQN-2010-00571
: HQN-2010-00593
: HQN-2010-00515
: HQN-2010-00550
: HQN-2010-00511
: HQN-2010-00510
: HQN-2010-00475
: HQN-2010-00499
: HQN-2010-00338
tP3-2009-04917
rP3-2009-04920
tP3-2009-04897
tP2-2009-05404
rP2-2009-05409
lP3-2009-04868
rP3-2009-04883
tP3-2009-04884
tP2-2010-04457
tP2-2010-04864
: PLP-2010-02288
: PLP-2010-02290
: PLP-2009-05942
: PNP-2008-03922
: PNP-2009-05359
: PNP-2010-00015
: RBS-2008-04685
: RBS-2009-05041
: RBS-2009-06123
: RBS-2009-06446
: RBS-2009-06451
: RBS-2009-06471
: RBS-2009-06473
: RBS-2009-06490
: RBS-2010-00044
wF3-2010-01198
wF3-2010-01356
wF3-2010-00746
wY-2010-04496
wY-2010-00070
: GGN-2010-02135
: GGN-2010-02382
: GGN-2010-02902
: GGN-2010-00590
: GGN-2010-01247
: GGN-2010-Q1252
: GGN-2009-06575
: GGN-2009-06904
: GGN-2009-06910
: GGN-2009-06505
: ANO-2010-01503
===Miscellaneous===
: Entergy Quarterly Trend Report, 2no Quarter 2010 Maintenance Rule (aX1) Systems List since December 2009 Operator Burdens Performance Indicator, November 2009 - October 2010 Operator Special Log Index, September  
: 2010 - December 2010 Operator Work Arounds Performance Indicator, November 2009 - October 2010 EOI Letter,
: ENOC-10-00002, Response to Request for lnformation, Rev. 1, January 8,2010 EOI Letter,
: ENOC-09-00037, Response to Request for Information, November 30, 2010 QAPM, Entergy Quality Assurance Program Manual, Rev. 0 through 20 Regulatory Guide 1.8, Personnel Selection and Training, Rev. 1 ANSI/ANS 3.1-1978, American National Standard for Selection and Training of Nuclear Power Plant Personnel, 1978 ANSI N18.1-1971, American National Standard for Selection and Training of Nuclear Power Plant Personnel, 1971 NRC SER, NRC Safety Evaluation Report, "Entergy Operations, Inc. Quality Assurance Program Consolidation," November 6, 1998 Technical Specification, Unit Staff Qualifications, Various 5.3.1, Personnel Change Planning ChecklisVForms for QA Manager Candidates, July 2007 CEO2009-00195, Corporate  
: ANSI Level lll Surveillance of W Maintenance Inspection Program (VfY), December 15,2009 EOI Letter,
: BVY 03-12, Vermont Yankee Nuclear Power Station, Docket No. 50-271, Annual Submittal of QAP Changes (WY), February 5, 2003
: CIN-2003/00059, Vermont Yankee, 10 CFR Part 50.54(a)(3)  
: Change Review, April 24,2002 EOI Letter No.,
: CNRO-2003-013, Forms for QAPM, Rev. 8 (VrY)EOI Letter No.,
: CNRO-2003-013, Forms for QAPM, Rev. 8 (VrY)EOI Letter No.,
: CEXO-20031164, Entergy Quality Assurance Program Manual, Rev. 8 (VfY),April24,2OA3EOI Letter No.,
: CEXO-20031164, Entergy Quality Assurance Program Manual, Rev. 8 (VfY), April24,2OA3
: CNRO-20021027,lssuance of Entergy Quality Assurance Program Manual(OAPM) Rev. 8 (\ffY), April24,200310
: EOI Letter No.,
: CFR 50.59, Review Form, Entergy Quality Assurance Program Manual, Rev. 7 (PNPS), April25.2002ENO Letter No., 1 .2.02-067, Entergy QA Program Manual, Rev. 7 (PNPS), May 2,20Q2EN-QV-104, Attachment 9,1, Entergy QA Program Manual, Rev. 7 (PNPS), Independent SpentFuel Storage Installation, July 30,2002ENOC Letter No. 07-0020, Entergy QA Program Manual Change Review Form 50.54(a) Parts1, 2 and 3 (PLP), April 5, 2007AP-20.06, Attachment 1, Entergy QA Program Manual, Rev. 16, Annual Report 10 CFR50.5a(a)(3) and10 CFR72.140(d) (PLP), April 15,2007MCM-4.1, Attachment 4.1, FSAR Change Request Form, Relocate QA Program from Chapter17 to Entergy QAPM (JAF), May 6,2002AP-20.09, Attachment 1, Nuclear Engineering 10
: CNRO-20021027,lssuance of Entergy Quality Assurance Program Manual (OAPM) Rev. 8 (\ffY), April24,2003
: CFR 50.59 Screening Form (JAF), April 3,2002Entergy Letter,
: CFR 50.59, Review Form, Entergy Quality Assurance Program Manual, Rev. 7 (PNPS), April 25.2002 ENO Letter No., 1 .2.02-067, Entergy QA Program Manual, Rev. 7 (PNPS), May 2,20Q2
: JLIC-02-017, Process Applicability Screening - Relocate QA Program FromFSAR Ch. 17 to Entergy QAPM (JAF), April 1 ,2002ENO Letter ,1.2.02-060, Cross Reference of QAPM Commitments to lmplementing Proceduresat JAF, April2, 20Q2A-12GGN-2010-03900GGN-2010-03451GGN-2010-03492ANO-1-2010-00743GGS-2009-06907GGS-2009-06920ANO-1-2009-02330PLP-2009-05897Attachment
: EN-QV-104, Attachment  
: A-13Entergy Letter,
: 9,1, Entergy QA Program Manual, Rev. 7 (PNPS), Independent Spent Fuel Storage Installation, July 30,2002 ENOC Letter No. 07-0020, Entergy QA Program Manual Change Review Form 50.54(a) Parts 1, 2 and 3 (PLP), April 5, 2007
: CNRO-2002-027, Adaptation of Entergy Common QAPM, Rev. 7 (JAF), June21,
: AP-20.06, Attachment  
: 200210
: 1, Entergy QA Program Manual, Rev. 16, Annual Report 10
: CFR 50.5a(a) Evaluation, Entergy QA Program Manual, Rev. 7 (JAF), April25,2002ENO Letter 1.2.02-060, QA Program Change/Prior Approval Determination - Part A (lP3), May6,2002ENO Meeting Summary, Adaptation of Entergy Common QAPM, Rev. 7, (lP2 and lP3), June 21,2002Development of Common QA Manual for Northern Entergy Sites and Entergy NuclearGenerating Company Plants, November 30, 2001Enqineerinq Chanqes/Maintenance Work OrdersANO-EC-07032
: CFR 50.5a(a)(3)
: RBS-EC-00893PLP-EC-05885
and10 CFR72.140(d) (PLP), April 15,2007
: ANO-EC-02886GGN-EC-o1452
: MCM-4.1, Attachment  
: PLP-EC-0g121GGN-EC-00224
: 4.1, FSAR Change Request Form, Relocate QA Program from Chapter 17 to Entergy QAPM (JAF), May 6,2002
: GGN-EC-02048RBS-EC-03643
: AP-20.09, Attachment  
: GGN-EC-02048ANO-EC-08043
: 1, Nuclear Engineering
: RBS-EC-03850PLP-EC-18042ANO-EC-00608GGN-EC-13354
: CFR 50.59 Screening Form (JAF), April 3, 2002 Entergy Letter,
: PLP-EC-06553GGN-EC-o2107
: JLIC-02-017, Process Applicability Screening - Relocate QA Program From FSAR Ch. 17 to Entergy QAPM (JAF), April 1 ,2002 ENO Letter ,1.2.02-060, Cross Reference of QAPM Commitments to lmplementing
: GGN-EC-13355RBS-EC-06947
===Procedures===
: GGN-EC-02110RBS-EC-07239
at JAF, April2, 20Q2 A-12 GGN-2010-03900
: GGN-EC-02201RBS-EC-08504
: GGN-2010-03451
: GGN-EC-02784RBS-EC-12204
: GGN-2010-03492
: GGN-EC-04538RBS-EC-13128
: ANO-1-2010-00743
: GGN-EC-06299RBS-EC-16451GGN-EC-06301RBS-EC-70752
: GGS-2009-06907
: GGN-EC-07471RBS-EC-07368
: GGS-2009-06920
: GGN-EC-07716RBS-EC-03852
: ANO-1-2009-02330
: GGN-EC-06875RBS-EC-03853
: PLP-2009-05897
: GGN-EC-06039RBS-EC-03975
: Entergy Letter,
: GGN-EC-06086RBS-EC-70733
: CNRO-2002-027, Adaptation of Entergy Common QAPM, Rev. 7 (JAF), June 21, 2002 10
: GGN-EC-00494Aud it Reports/Su rvei llancesCorporate ANSI Level lll Surveillance of WPNP Pre-NIEP 2009 ReportPNP Pre-NIEP 2010W Pre-NIEP 2007
: CFR 50.5a(a) Evaluation, Entergy QA Program Manual, Rev. 7 (JAF), April25,2002
: LO-WYLO-2007-00029Palisades Pre-NIEP 2009Palisades 2008 Pre-NIEP ReportJAF Pre-NIEP August 2007IPEC Pre-NIEP 2009IPEC 2008 Pre- NIEP AssessmentGGNS Pre-NIEP Report final May 2008GGNS Pre-NIEP 2009ANO Pre-NIEP 2010WF3 Pre-NtEP 2007 W3 CEO2008-00026QA-13-2009-PLP-01 PLP NIEP 2009QA-13-2009-GGNS.1 GGNS NIEP 2OO9QA-13-2007-)/Y-1 NIEP AUDIT REPORTNIEP - River Bend - 2007JAF
: ENO Letter 1.2.02-060, QA Program Change/Prior Approval Determination - Part A (lP3), May 6,2002 ENO Meeting Summary, Adaptation of Entergy Common QAPM, Rev. 7, (lP2 and lP3), June 21, 2002 Development of Common QA Manual for Northern Entergy Sites and Entergy Nuclear Generating Company Plants, November 30, 2001 Enqineerinq Chanqes/Maintenance
: QA 2008 NIEP ReportRBS-EC-70734RBS-EC-02692ANO-EC-03069PLP-EC-12392GGN-EC-02065GGN-EC-02058RBS-EC-03275WF3-EC-15451PLP-EC-12731ANO U-1
===Work Orders===
: EC 01039ANO U-1
: ANO-EC-07032  
: EC 05808ANO U-1
: RBS-EC-00893
: EC 13153ANO U-1
: PLP-EC-05885  
: EC 00380ANO U-1
: ANO-EC-02886
: EC 05054ANO U-1
: GGN-EC-o1452  
: EC 05388ANO U-1 EC06241ANO U-1
: PLP-EC-0g121
: EC 07032ANO U-1
: GGN-EC-00224  
: EC 13224WF3-EC-844881wF3-EC-05854VYT-EC-o3138Inspection ProgramGGN-EC-o1450GGN-EC-OOO85RBS-EC-03275ANO-EC-04461PLP-EC-14181GGN-EC-13326GGN-EC-02065RBS-EC-05932wF3-EC-10706WF3-EC-o1830wF3-EC-07960WF3-EC-01166wF3-EC-09046wF3-EC-00935WF3-EC-01166wF3-EC-01396WF3-EC-01782WF30EC-03013wF3-EC-11284WF3-EC-13981Attachment
: GGN-EC-02048
: A-14IPEC 2009 NIEP ReportWF3 NIEP 2OO8QA-1 0-2006-VY-1 MaintenanceQA-1 0-2006-RBS-1 MaintenanceQA-1 0-2006-JAF-1 MaintenanceQA-1 0-2006-PNP- 1 MaintenanceQA-1 0-2006-l P-1 MaintenanceQA-1 0-2006-GGNS-1 MaintenanceQA-1 0-2006-ANO-1 MaintenanceQA-1 0-2006-WF3-1 MaintenanceQS-2010-PLP-017 PLP QC Inspection ProgramQS-201O-GGNS-O11 GGNS QC Inspection ProgramQS-2010-ECH-008 ANSI Level lll of
: RBS-EC-03643  
: IPECQS-2010-ECH-007 Review of EOC for QC Inspection Point SelectionQS-2010-ECH-006 Review of Fleet lnterim ActionsQS-2010-ECH-002 ANSI Level lll of
: GGN-EC-02048
: PNPOS-2010-ECH-001 ANSI Level lll of
: ANO-EC-08043  
: GGNSQS-2009-VY-004 VY Inspection ProgramQS-2009-VY-020 VY Maintenance Inspection ProgramQS-2009-ANO-006 Corporate ANSI Level lll of
: RBS-EC-03850
: ANOQS-2008-VY-004 Peer Inspector Qualification DocumentationQS-201 0-PNPS-01 9 PNP Inspection ProgramQA-1 0-2008-VY- 1 MaintenanceQA-1 0-2008-RBS-1 MaintenanceQA- 1 0-2008-PNP- 1 MaintenanceQA-1 0-2008-PLP-1 MaintenanceQA-1 0-2008-JAF-1 MaintenanceQA-1 0-2008-lP-1 MaintenanceQA- 1 0-2008-GGNS-1 MaintenanceQA-1 0-2008-ANO-1 MaintenanceQA-1 0-2008-WF3-1 Maintenance
: PLP-EC-18042
: ANO-EC-00608
: GGN-EC-13354  
: PLP-EC-06553
: GGN-EC-o2107  
: GGN-EC-13355
: RBS-EC-06947  
: GGN-EC-02110
: RBS-EC-07239  
: GGN-EC-02201
: RBS-EC-08504  
: GGN-EC-02784
: RBS-EC-12204  
: GGN-EC-04538
: RBS-EC-13128  
: GGN-EC-06299
: RBS-EC-16451
: GGN-EC-06301
: RBS-EC-70752  
: GGN-EC-07471
: RBS-EC-07368  
: GGN-EC-07716
: RBS-EC-03852  
: GGN-EC-06875
: RBS-EC-03853  
: GGN-EC-06039
: RBS-EC-03975  
: GGN-EC-06086
: RBS-EC-70733  
: GGN-EC-00494
: Aud it Reports/Su rvei llances Corporate
: ANSI Level lll Surveillance of W PNP Pre-NIEP 2009 Report PNP Pre-NIEP 2010 W Pre-NIEP 2007 LO-WYLO-2007-00029
: Palisades Pre-NIEP 2009 Palisades
: 2008 Pre-NIEP Report JAF Pre-NIEP August 2007 IPEC Pre-NIEP 2009 IPEC 2008 Pre- NIEP Assessment
: GGNS Pre-NIEP Report final May 2008 GGNS Pre-NIEP 2009 ANO Pre-NIEP 2010 WF3 Pre-NtEP 2007 W3 CEO2008-00026
: QA-13-2009-PLP-01  
: PLP NIEP 2009
: QA-13-2009-GGNS.1  
: GGNS NIEP 2OO9
: QA-13-2007-)/Y-1  
: NIEP AUDIT REPORT NIEP - River Bend - 2007 JAF
: QA 2008 NIEP Report RBS-EC-70734
: RBS-EC-02692
: ANO-EC-03069
: PLP-EC-12392
: GGN-EC-02065
: GGN-EC-02058
: RBS-EC-03275
: WF3-EC-15451
: PLP-EC-12731
: ANO U-1
: EC 01039 ANO U-1
: EC 05808 ANO U-1
: EC 13153 ANO U-1
: EC 00380 ANO U-1
: EC 05054 ANO U-1
: EC 05388 ANO U-1 EC06241 ANO U-1
: EC 07032 ANO U-1
: EC 13224 WF3-EC-844881
wF3-EC-05854
: VYT-EC-o3138
: Inspection Program GGN-EC-o1450
: GGN-EC-OOO85
: RBS-EC-03275
: ANO-EC-04461
: PLP-EC-14181
: GGN-EC-13326
: GGN-EC-02065
: RBS-EC-05932
wF3-EC-10706
: WF3-EC-o1830
wF3-EC-07960
: WF3-EC-01166
wF3-EC-09046
wF3-EC-00935
: WF3-EC-01166
wF3-EC-01396
: WF3-EC-01782
: WF30EC-03013
wF3-EC-11284
: WF3-EC-13981
: IPEC 2009 NIEP Report WF3 NIEP 2OO8
: QA-1 0-2006-VY-1  
: Maintenance
: QA-1 0-2006-RBS-1  
: Maintenance
: QA-1 0-2006-JAF-1  
: Maintenance
: QA-1 0-2006-PNP-  
: Maintenance
: QA-1 0-2006-l P-1 Maintenance
: QA-1 0-2006-GGNS-1  
: Maintenance
: QA-1 0-2006-ANO-1  
: Maintenance
: QA-1 0-2006-WF3-1  
: Maintenance
: QS-2010-PLP-017  
: PLP QC Inspection Program
: QS-201O-GGNS-O11  
: GGNS QC Inspection Program
: QS-2010-ECH-008  
: ANSI Level lll of IPEC
: QS-2010-ECH-007  
: Review of EOC for QC Inspection Point Selection
: QS-2010-ECH-006  
: Review of Fleet lnterim Actions
: QS-2010-ECH-002  
: ANSI Level lll of PNP
: OS-2010-ECH-001  
: ANSI Level lll of GGNS
: QS-2009-VY-004  
: VY Inspection Program
: QS-2009-VY-020  
: VY Maintenance Inspection Program
: QS-2009-ANO-006  
: Corporate  
: ANSI Level lll of ANO
: QS-2008-VY-004  
: Peer Inspector Qualification Documentation
: QS-201 0-PNPS-01  
: PNP Inspection Program
: QA-1 0-2008-VY-  
: Maintenance
: QA-1 0-2008-RBS-1  
: Maintenance
: QA- 1 0-2008-PNP-  
: Maintenance
: QA-1 0-2008-PLP-1  
: Maintenance
: QA-1 0-2008-JAF-1  
: Maintenance
: QA-1 0-2008-lP-1  
: Maintenance
: QA- 1 0-2008-GGNS-1  
: Maintenance
: QA-1 0-2008-ANO-1  
: Maintenance
: QA-1 0-2008-WF3-1  
: Maintenance


==Section 4OA3: Event Follow-upProcedures2-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 542-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75EN-Ll-102, Corrective Action Process, Rev. 16lP-SMM-OP-105, Post Transient Evaluation, Rev. 6IPEC Emergency Plan, Revision 09-01lP-EP-1 15, Emergency Plan Forms, Revision 27lP-EP-120, Emergency Classification, Revision 4IP-EP'210, Central Control Room, Revision 7Completed ProcedureslP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 19, 2010Condition Reports (CR-lP2-)2c10-A7092 2010-5082Attachment==
==Section 4OA3: Event Follow-up Procedures==
: A-15MiscellaneousEntergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated August17,2010, Subject: Inspection of Dry Cask Components pertaining to stuck MPCcondition from August 12,2010Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International datedNovember 23,2010Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International datedDecember 1,2010, Subject: lnspection of Dry Cask Components pertaining to stuckMPC condition from November 19.2010Holtec International letter dated August 16,2Q10, to Tim Salentino, IPEC,and Thermal review of Stuck MPC condition at lP2Holtec International letter dated August 18,2010, to Tim Salentino, IPEC,of MPC transfer at lP2Holtec International letter dated November 24, 2010, to IPEC, containing the thermal andstructural assessment of the stuck MPC condition at lP2Holtec International e-mail correspondence from Kevin Cuthill to Tim Salentino, IPEC, datedDecember 1,2010IPEC Procedure Review and Approval Form lP-SMM-AD-102, Rev. 6, for Procedure MPCTransfer &
: 2-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 54 2-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75
: HI-STORM Movement, No. 2-DSC-009-GEN, Rev. 8IPEC Unit 2 Alert Report, November 7, 2010 (dated December 1, 2010)Audio tapes of the Radiological Emergency Communication System from November 7,2010Software Change Request
: EN-Ll-102, Corrective Action Process, Rev. 16 lP-SMM-OP-105, Post Transient Evaluation, Rev. 6 IPEC Emergency Plan, Revision 09-01 lP-EP-1 15, Emergency Plan Forms, Revision 27 lP-EP-120, Emergency Classification, Revision 4
: IP-EP'210, Central Control Room, Revision 7 Completed 
===Procedures===
lP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 19, 2010 Condition Reports (CR-lP2-)2c10-A7092  
: 2010-5082 Attachment 
===Miscellaneous===
: Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated August 17,2010, Subject: Inspection of Dry Cask Components pertaining to stuck MPC condition from August 12,2010 Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated November 23,2010 Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated December 1,2010, Subject: lnspection of Dry Cask Components pertaining to stuck MPC condition from November 19.2010 Holtec International letter dated August 16,2Q10, to Tim Salentino, IPEC, and Thermal review of Stuck MPC condition at lP2 Holtec International letter dated August 18,2010, to Tim Salentino, IPEC, of MPC transfer at lP2 Holtec International letter dated November 24, 2010, to IPEC, containing the thermal and structural assessment of the stuck MPC condition at lP2 Holtec International
e-mail correspondence from Kevin Cuthill to Tim Salentino, IPEC, dated December 1,2010 IPEC Procedure Review and Approval Form lP-SMM-AD-102, Rev. 6, for Procedure  
: MPC Transfer &
: HI-STORM Movement, No. 2-DSC-009-GEN, Rev. 8 IPEC Unit 2 Alert Report, November 7, 2010 (dated December 1, 2010)Audio tapes of the Radiological Emergency Communication System from November 7,2010 Software Change Request
: SCR-2010-0432, for revising
: SCR-2010-0432, for revising
: MIDAS-USER-IPC 1.5.13.110Standard Test Case MIDAS lnstallation Revision 3
: MIDAS-USER-IPC  
: 1.5.13.110
: Standard Test Case MIDAS lnstallation Revision 3
 
==Section 4OA5: Other Activities==


==Section 4OA5: Other ActivitiesProceduresEN-Ll-102, Corrective Action Process, Rev. 15EN-Ll-1 21, Entergy Trending Process, Rev. 8EN-MA-102, Inspection Program, Rev. 3 and 4EN-OP-115, Conduct of Operations, Rev. 9EN-QV-100, Conduct of Nuclear Oversight, Rev. 4MiscellaneousTechnical Specification, Unit Staff Qualifications, VariousSubject: StructuralSubject: ResumptionAttachment==
===Procedures===
: ADAMSALARACACAPCARBCCRCFRCRCRGCRSDGDRADRPDRSEALEDGEPEPIPEROFRVFSBHoltecHRAtMcIPECISFSIJPMMBFPMPCNCVNEINRCODCMPCVPFPPIPMTPTRGQPRARCSRECSRETSRORSPSRWPSGISISROSSA-16
: EN-Ll-102, Corrective Action Process, Rev. 15
: EN-Ll-1 21, Entergy Trending Process, Rev. 8
: EN-MA-102, Inspection Program, Rev. 3 and 4
: EN-OP-115, Conduct of Operations, Rev. 9
: EN-QV-100, Conduct of Nuclear Oversight, Rev. 4 Miscellaneous Technical Specification, Unit Staff Qualifications, Various Subject: Structural Subject: Resumption
: ADAMS ALARA CA CAP CARB CCR CFR CR CRG CRS DG DRA DRP DRS EAL EDG EP EPIP ERO FRV FSB Holtec HRA tMc IPEC ISFSI JPM MBFP MPC NCV NEI NRC ODCM PCV PFP PI PMT PTRG QP RA RCS RECS RETS RO RSPS RWP SGI SI SRO SS A-16
==LIST OF ACRONYMS==
==LIST OF ACRONYMS==
Agencywide Document and Management SystemAs Low As Reasonably AchievableCorrective ActionCorrective Action ProgramCorrective Action Review BoardCentral Control RoomCode of Federal RegulationsCondition ReportCondition Review GroupControl Room SupervisorDiesel GeneratorDeputy Regional AdministratorDivision of Reactor ProjectsDivision of Reactor SafetyEmergency Action LevelEmergency Diesel GeneratorEmergency PlanEmergency Plan lmplementing ProcedureEmergency Response OrganizationFeed Regulation ValveFuel Storage BuildingHoltec InternationalHigh Radiation AreaInspection Manual ChapterIndian Point Energy CenterIndependent Spent Fuel Storage InstallationJob Performance MeasuresMain Boiler Feed PumpMultipurpose CanisterNon-Cited ViolationNuclear Energy lnstitute, lnc.Nuclear Regulatory CommissionOffsite Dose Calculation ManualPressure ControlValvePre-Fire PlanPerformance IndicatorPost-Maintenance Testi ngPost-Trip Review GroupAugmented QualityRegional AdministratorReactor Coolant SystemRadiological Emergency Communication SystemRad iolog ical Effluent Techn ical SpecificationReactor OperatorRisk Significant Planning StandardRadiation Work PermitSafeguards InformationSafety InjectionSenior Reactor OperatorShift SupervisorAttachment
Agencywide
: [[SSCSWP]] [[TRMTSUFSARURIVHRAWOA-17Structure, System, and ComponentService Water PumpTechnical Requirements ManualTechnical SpecificationsUpdated Final Safety Evaluation ReportUnresolved ltemVery High Radiation AreaWork OrderAttachment]]
Document and Management
System As Low As Reasonably
Achievable
Corrective
Action Corrective
Action Program Corrective
Action Review Board Central Control Room Code of Federal Regulations
Condition
Report Condition
Review Group Control Room Supervisor
Diesel Generator Deputy Regional Administrator
Division of Reactor Projects Division of Reactor Safety Emergency
Action Level Emergency
Diesel Generator Emergency
Plan Emergency
Plan lmplementing
Procedure Emergency
Response Organization
Feed Regulation
Valve Fuel Storage Building Holtec International
High Radiation
Area Inspection
Manual Chapter Indian Point Energy Center Independent
Spent Fuel Storage Installation
Job Performance
Measures Main Boiler Feed Pump Multipurpose
Canister Non-Cited
Violation Nuclear Energy lnstitute, lnc.Nuclear Regulatory
Commission
Offsite Dose Calculation
Manual Pressure ControlValve
Pre-Fire Plan Performance
Indicator Post-Maintenance
Testi ng Post-Trip
Review Group Augmented
Quality Regional Administrator
Reactor Coolant System Radiological
Emergency
Communication
System Rad iolog ical Effluent Techn ical Specification
Reactor Operator Risk Significant
Planning Standard Radiation
Work Permit Safeguards
Information
Safety Injection Senior Reactor Operator Shift Supervisor
: [[SSC]] [[]]
: [[SWP]] [[]]
: [[TRM]] [[]]
: [[TS]] [[]]
: [[UFSAR]] [[]]
: [[URI]] [[]]
: [[VHRA]] [[]]
WO A-17 Structure, System, and Component Service Water Pump Technical
Requirements
Manual Technical
Specifications
Updated Final Safety Evaluation
Report Unresolved
ltem Very High Radiation
Area Work Order Attachment
}}
}}

Revision as of 07:48, 14 August 2018

IR 05000247-10-005; 10/01/2010-12/31/2010; Indian Point Nuclear Generating Unit 2; Post-Maintenance Testing; Occupational ALARA Planning and Controls; Identification and Resolution of Problems; Event Follow-up; and Other Activities
ML110420231
Person / Time
Site: Indian Point Entergy icon.png
Issue date: 02/11/2011
From: Gray M K
Reactor Projects Branch 2
To: Pollock J E
Entergy Nuclear Operations
Gray, Mel NRC/RGNI/DRP/PB2/610-337-5209
References
IR-10-005
Download: ML110420231 (76)


Text

UNITED STATES NUCLEAR REGULATORY COMMISSION REGION I 4T5ALLENDALE ROAD KING OF PRUSSIA, PA 19406-1415 February 11, 20II Mr. Joseph Site Vice President Entergy Nuclear OPerations, Inc.Indian Point EnergY Center 450 Broadway, GSB Buchanan.

NY 1051 1'0249

SUBJECT: INDIAN POINT NUCLEAR GENEMTING UNIT 2 - NRC ]NTEGMTED I NSPECTION REPORT 05000247 120 1 0005

Dear Mr. Pollock:

On December 31 ,2010, the U.S. Nuclear Regulatory Commission (NRC) completed an inspection at lndian point Nuclear Generating unit z. rne enclosed integrated inspection report documents the inspection results, which wer6 discussed on January 19,2011 with you and other members of Your staff.The inspection examined activities conducted under your license as they relate to safety and compliance with the Commission's rules and regulations, and with the conditions of your license. The inspectors reviewed selected procedures and records, observed activities, and interviewed personnel.

This report documents four NRC-identified and five self-revealing findings of very low safety significance (Green). Additionally, two licensee-identified violations which were determined to nJ oi u"w low safety significance are listed in this report. Six findings were determined to involve violations of f.f nlC requirements.

However, because of their very low safety significance and because they are entered into your corrective action program, the_NfC is treating these as non-cited violations (NCVs) consistbnt with Sectio n 2.3.2 of the NRC Enforcement Policy. lf you contest these ruCvs) you s'hould provide a response within 30 days of the date of this inspection report, with the Oasis ior your denial, to the Nuclear Regulatory Commission,.ATTN':

Document control Desk, washingtoh Dc 20555-0001; with copieJto the Regional Administrator, Region 1;the Director, bffice of Enforcement, United States Nuclear Regulatory Commission, washington, DC 20555-0001; and the NRC Senior Resident lnspector at Indian Point Nuclear G"n"r"iing Unit 2. ln addition, if you disagree with the cross-cutting aspect assigned to the findings inlnis report, you should provide a response within 30 days of the date of this inspeition report, witnine basis for your disagreement, to the Regional Administrator, Region 1, and the NRC Senior Resident lnspector at lndian Point Nuclear Generating Unit 2. In accordance with Title 10 of the Code of Federal Regulations (10 CFR) Part 2.390 of the NRC's "Rules of Practice," a copy of this letter, its enclosure, and your response (if any) will be available electronically for public inspection in the NRC Public Document Room of from the Publicly Available Records component of the NRC's document system (ADAMS). ADAMS is accessible from the NRC Web Site at http://wmv.nrc.oov/readinq{m/adams.html (the Public Electronic Reading Room).

Sincerely,/atN, Mel Gray, Chief Projects Branch 2 Division of Reactor Projects 50-247 DPR-26 f nspection Report No. 050002 47 12010005 w/

Attachment:

Supplemental Information Distribution via ListServ Docket No.License No.

Enclosure:

cc w/encl:

SUMMARY OF FINDINGS

lR 0500024712010005i 1010112010 - 1213112010:

Indian Point Nuclear Generating (lndian Point) Unit 2; Post-Maintenance Testing; OccupationalALARA Planning and Controls;ldentification and Resolution of Problems;

Event Follow-up; and Other Activities.

This report covered a three-month period of inspection by resident and region based inspectors.

Six non-cited violations (NCVs) and three findings of very low safety significance (Green) were identified.

The significance of most findings is indicated by their color (Green, White, Yellow, Red) using lnspection Manual Chapter (lMC) 0609, "Significance Determination Process (SDP)." The cross-cutting aspect for the findings was determined using IMC 0310,"Components within the Cross-Cutting Areas." Findings for which the significance determination process does not apply may be Green, or be assigned a severity level after NRC management review. The NRC's program for overseeing safe operation of commercial nuclear power reactors is described in NUREG-1649, "Reactor Oversight Process," Revision 4, dated December 2006.

Cornerstone: Initiating

Events.

Green.

A Green self-revealing finding was identified because Entergy's procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump (MBFP) Discharge Pressure Speed Control," did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations.

Specifically, between May 5, 2006 and September 3, 2010, procedure 2-lC-PC-N-P-408A did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations, resulting in a slow MBFP response, which contributed to a reactor trip from 41o/o power. Entergy personneltook immediate corrective actions to change the MBFP speed controller settings.

This issue was entered into Entergy's corrective action program (CAP) as condition report (CR)-lP2-2010-05484.

This finding is more than minor because it is associated with the design control attribute of the Initiating Events cornerstone and affects the cornerstone objective of limiting the likelihood of those events that upset plant stability and challenge critical safety functions during power operations.

Specifically, inadequate design control of the MBFP speed controller settings contributed to a reactor trip. Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding did not contribute to the likelihood that mitigation equipment or functions would not be available.

The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect Entergy's current performance.

Specifically, the performance deficiency occuned more than three years ago and was outside the current assessment period. (Section 4OA3)

Cornerstone: Mitigating

Systems o

Green.

The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion X,"lnspection," because Enter,gy personnel did not ensure that quality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for construction-like work activities as required by the quality assurance program (OAP). Entergy personnel performed extensive reviews and initiated prompt fleet-wide corrective actions to ensure proper work order evaluation and proper inclusion of quality control verification inspections.

This issue was entered into Entergy's corrective action program (CAP) as CR-HQN-2009-01184 and CR-HQN-2010-001 3.This finding is more than minor because it is a programmatic deficiency that if left uncorrected, could lead to a more significant safety concern in that the failure to check quality attributes could involve an actual impact to plant equipment.

This finding is associated with the design control attribute of the Mitigating Systems cornerstone because missed quality control inspections during plant modifications could impact the availability, reliability, and capability of systems needed to respond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding is a qualification deficiency confirmed not to result in a loss of operability or functionality.

Specifically, inspectors verified by sampling that work documents provided objective quality evidence that work activities that had missed quality control verifications were properly performed.

The finding has a cross-cutting aspect in the area of human performance associated with the decision-making attribute because Entergy personnel did not have an effective systematic process for obtaining interdisciplinary reviews of proposed work instructions to determine whether Quality Controlverification inspections were appropriate.

H.1(a)per IMC 03101 (Section 4OA2)Green. The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion ll,"Quality Assurance Program (QAP)," because Entergy personnel did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of quality assurance manager (OAM) met the qualification and experience requirements of ANSI/ANS 3.1-1978.

Specifically, the individual assigned as the responsible person for the Entergy's overall implementation of the QAP did not have at least one year of nuclear plant experience in the overall implementation of the QAP within the quality assurance organization prior to assuming those responsibilities.

This issue was entered into Entergy's CAP as CR-HQN-2010-00386.

This finding is more than minor because if left uncorrected, it could lead to a more significant safety concern. Specifically, the failure to have a fully qualified individual providing overall oversight to the QAP had the potential to affect all cornerstones.

However, this finding will be tracked under the Mitigating Systems cornerstone as the area most likely to be impacted.

The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.

Using IMC 0609, Appendix M, "significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green)because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist.The inspectors determined there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy's current performance.

Specifically, the performance deficiency occurred more than three years ago and was outside the current assessment period. (Section 4C.A2)

5.

Green.

A Green self-revealing NCV of Technical Specification (TS) 5.1, "Responsibility," was identified because on February 9, 2010, the control room supervisor (CRS)assigned as having the control room command function, left the control room without designating another senior reactor operator (SRO) qualified individual to assume the control room command function.

The CRS promptly returned to the control room shortly after the issue was identified.

This issue was entered into Entergy's CAP as CR-lP2-201 0-00708.The finding is more than minor because it could be reasonably viewed as a precursor to a significant event. Specifically, the absence of SRO oversight during licensed control room activities increases the likelihood of human performance errors contributing to an initiating event and reduces the effectiveness of event mitigation.

The finding is associated with the human performance attribute of the Mitigating Systems cornerstone and affects the cornerstone objective of ensuring the availability, reliability and capability of systems that respond to initiating events to prevent undesirable consequences.

The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.

Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green) because of the short period the CRS was absent from the control room, and because no initiating events occurred during that time.The finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute because of the ineffective use of shift turnover practices, in that the CRS did not self check or communicate his decision to leave the control room to the rest of the control room staff. H.4(a) per IMC 0310] (Section 4OA5)Gornerstone:

Emergency Preparedness.

Green.

The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because Entergy staff did not implement adequate compensatory measures when the R-27 plant vent process radiation monitor, which is used for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor was out of service for repair following preventive maintenance with inadequate compensatory measures regarding the impact on EAL classification capability.

Entergy personnel implemented shortterm corrective actions by providing adequate compensatory instructions for the operating crews. The issue was entered into Entergy's CAP as CR-lP-2010-06721 which includes longer-term corrective actions regarding emergency preparedness procedure changes.This finding is more than minor because it affected the Emergency Response Organization attribute of the Emergency Preparedness (EP) cornerstone to ensure that the Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

Specifically, Entergy personnel did not provide adequate compensatory measures for when the R-27 plant vent monitors were taken out of service. In accordance with IMC 0609, Appendix B,"Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.9 and Sheet 1, "Failure to Comply," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to event classification (10 CFR 50.47(bX4))

was a risk-significant planning standard (RSPS)problem; but it was not a RSPS functional failure of the Indian Point Energy Center (IPEC) event classification process.This finding has a cross-cutting aspect in the area of problem identification and resolution associated with the corrective action program attribute of taking appropriate corrective actions to address safety issues in a timely manner. Specifically, Entergy staff did not take appropriate emergency planning compensatory corrective actions when the R-27 plant vent radiation monitor was taken out of service, tP.1(d) per IMC 03101 (Section 1R19)Green. A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), was identified because Entergy staff did not adequately implement the requirements of the IPEC Emergency Plan. On the evening of November 7, 2010, the Unit 2 operators declared an Alert emergency at 1849 hours0.0214 days <br />0.514 hours <br />0.00306 weeks <br />7.035445e-4 months <br />. The technical support center (TSC) was staffed and declared operational at 2008 hours0.0232 days <br />0.558 hours <br />0.00332 weeks <br />7.64044e-4 months <br />, and the operations support center (OSC) was staffed and declared operational at 2015 hours0.0233 days <br />0.56 hours <br />0.00333 weeks <br />7.667075e-4 months <br />. Both of these activation times exceeded the 60-minute staffing requirement in the IPEC Emergency Plan. This issue was entered into Entergy's CAP as CR-lP2-2010-6813, CR-lP2-2010-6831, and CR-IP2-2010-6871.

This finding is more than minor because it affected the Emergency Response Organization (ERO) attribute of the EP cornerstone to ensure that Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

Entergy personnel did not meet the requirements of the IPEC Emergency Plan in that the TSC and OSC were not staffed nor declared operational within 60 minutes of the Alert emergency declaration on November 7,2010.In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.2 and Sheet 2, "Actual Event lmplementation Problem," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to ERO augmentation (10 CFR 50.47(bX2))

was a non-risk-significant planning standard problem which occurred during an Alert emergency and is therefore of very low safety significance (Green).This finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute of defining and effectively communicating expectations regard ing proced u ral com pliance and personnel following proced ures. Specifically, Entergy staff did not comply with ERO expectations and procedures regarding prompt reporting to an assigned emergency response facility during an actual event. H.4(b) per IMC 03101 (Section 4OA3)Green. The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because the Entergy emergency plan implementing procedure (EPIP) for notification of offsite officials did not meet the requirements of the IPEC Emergency Plan. This EPIP had contained a deficiency in the backup process for offsite notification since July 2006. Entergy personnel responded by documenting the deficiency in CR-lP2-2010-07563 and by initiating a procedure change to align the backup process with the Emergency Plan commitments.

7 This finding is more than minor because it affected the Emergency Response Organization attribute of the EP cornerstone to ensure that the Entergy personnel are capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

Entergy procedures allowed for a back-up notification process that did not comply with the requirements of the site emergency plan: the Emergency Plan requires that the Shift Manager or his designee notify the offsite authorities of an emergency declaration, while Form EP-4 directed the delegation of this responsibility to an offsite authority itself. In accordance with Inspection Manual Chapter (lMC) 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Using IMC 0609, Appendix B, Section 4.5 and Sheet l, "Failure to Comply," the inspectors determined that the failure to comply with an aspect of the Emergency Plan related to event notification (10 CFR 50.47(bX5))

was a RSPS problem. lt was not a RSPS functional failure of the IPEC event notification process, because the deficiency in the IPEC EPIP was in the backup method for offsite notification, and despite the proceduralflaw offsite notifications were made in a timely and accurate manner on November 7,2010.The inspectors determined there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy's current performance.

Specifically, the performance deficiency associated with a procedure change made in July 2006 occurred more than three years ago and was outside the current assessment period. (Section 4OA3)

Cornerstone: Occupational

Radiation Safety.

Green.

A Green self-revealing finding was identified because Entergy personnel did not adequately plan and control work activities related to a regenerative heat exchanger permanent shielding modification in accordance with radiation work permit (RWP)20102537 , "2R19 Permanent Regen Hx Shielding." Specifically, Entergy personnel did not perform walkdowns to support modification package planning and provided limited field supervision which resulted in significant unplanned collective exposure (17189 person-rem compared to a revised work activity estimate of 8.000 person-rem).

This issue was entered into Entergy's CAP as CR-IP2-2010-02817.

The finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.

Additionally, this finding is similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E, "Examples of Minor lssues," because it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%. Using IMC 0609, Appendix C,"Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an as low as reasonably achievable (ALARA) planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2Q07-2Q09).

The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy's planned work activities did not adequately incorporate the job site interferences and their resolution in accordance with radiological safety. H.3(a) per IMC 0310] (Section 2RS2)Green. A Green self-revealing finding was identified because Entergy personneldid not adequately plan and control work activities related to reactor cavity liner repair in accordance with RWP 20102530, "2R19 Cavity Liner Repair." Specifically, outage schedule delay and inadequate work coordination resulted in the use of back-up workers to perform the reactor cavity sealant removalwork, and also resulted in reactor head shielding removal and cancellation of additional shielding that was specified in the ALARA plan, which resulted in significant unplanned collective exposure (7.058 person-rem compared to a revised work activity estimate of 3.635 person-rem).

This issue was entered into Entergy's CAP as CR-lP2-2010-02817.

This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.

lt is also similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E, "Examples of Minor lssues," because it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%. Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an as low as reasonably achievable (ALARA) planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007 -2009).The finding has a cross-cutting aspect in the area of human performance associated with the work coordination attribute because Entergy personnel did not coordinate and implement work activities as planned, which resulted in significant dose overrun. H.3(b)per IMC 03101 (Section 2RS2)

Other Findings

Violations of very low safety significance, which were identified by Entergy personnel, have been reviewed by the inspectors.

Corrective actions taken or planned have been entered into Entergy's CAP. The violations and corrective actions are listed in Section 4OA7 of this report.Enclosure 9

REPORT DETAILS

Summarv of Plant Status Indian Point Unit 2began the inspection period operating at full reactor power (100%). The Unit 2 reactor automatically tripped on November 7,2010, due to a fault on the 21 main transformer

'B' phase bushing which resulted in an Alert emergency declaration.

Unit 2 remained shutdown to replace the 21 main transformer, and returned to full power on November 25,2010. Unit 2 remained at or near full power during the remainder of the inspection period.1. REACTORSAFETY Cornerstones:

Initiating Events, Mitigating Systems, and Barrier Integrity 1R01 Adverse Weather Protection (71111.01 - 1 sample)lmpending Adverse Weather

a. Inspection Scope

Because severe weather was forecast in the vicinity of the facility for December 1,2Q1Q, the inspectors reviewed Entergy staff's overall preparations/protection for the expected weather conditions.

The inspectors walked down systems required for normal operation and shutdown conditions because their safety related functions could be affected, or required, as a result of flooding.

The inspectors evaluated the plant staff's preparations in accordance with site procedures to determine if actions were adequate.

During the inspection, the inspectors focused on plant specific design features and station procedures used to respond to adverse weather conditions.

The inspectors also toured the site to identify loose debris that could become projectiles during a tornado. The inspectors evaluated operator staffing and accessibility of controls and indications for those systems required to controlthe plant. Additionally, the inspectors reviewed the Updated Final Safety Analysis Report (UFSAR) and performance requirements for the systems selected for inspection, and reviewed whether operator actions were appropriate as specified by plant specific procedures.

The inspectors also reviewed a sample of CAP items to verify whether Entergy personnel identified adverse weather impact issues at an appropriate threshold and dispositioned them through the CAP in accordance with station corrective action procedures.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one sample as defined in NRC Inspection Procedure 71111.01.Findinqs No findings were identified.

10 1R04 Equipment Aliqnment (71111.04Q - 3 samples)Partial Svstem Walkdowns

a. Inspection Scope

The inspectors performed partial system walkdowns of the following risk significant systems:. October 8, 2Q10, Appendix R diesel generator (DG) after jacket water leak repair;. October 25,2010,22 emergency diesel generator (EDG) after a maintenance outage; and. November 3, 2010,22 auxiliary component cooling water train after surveillance testing.The inspectors selected these systems based on their risk significance relative to the reactor safety cornerstones at the time they were inspected.

The inspectors focused on those conditions that could affect the function of the system, and, therefore, potentially increase risk. The inspectors reviewed applicable operating procedures, system diagrams, UFSAR, technical specification requirements, technical specifications (TSs), work orders (WOs), CRs and the impact of ongoing work activities on redundant trains of equipment in order to identify conditions that could have impacted system performance of their intended safety functions.

The inspectors also inspected accessible portions of the systems to verify system components and support equipment were aligned correctly and operable.

The inspectors examined the material condition of the components and observed operating parameters of equipment to verify that there were no deficiencies.

The inspectors also reviewed whether Entergy staff had properly identified and resolved equipment alignment problems that could cause initiating events or impact the capability of mitigating systems or barriers and entered them into the CAP with the appropriate sign ificance cha racterization.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of three partial system walkdown samples as defined in NRC lnspection Procedure 7 1111

.04. b. Findinqs No findings were identified.

1R05 Fire Protection

(71111.05Q - 5 samples)Resident Inspector Quarterlv Walkdowns a. lnspection Scope The inspectors conducted fire protection walkdowns that were focused on availability, accessibility, and the condition of firefighting equipment in the following risk significant plant areas: Enclosure b.11 r Pre-Fire Plan (PFP)-216; o PFP-2524;o PFP-260;. PFP-261; and o PFP-262.The inspectors reviewed areas to assess if Entergy personnel implemented a fire protection program that adequately controlled combustibles and ignition sources within the plant; effectively maintained fire detection and suppression capability; maintained passive fire protection features in proper material condition; and implemented adequate compensatory measures for out of service, degraded or inoperable fire protection equipment, systems, or features, in accordance with the station's fire plan. The inspectors selected fire areas based on their overall contribution to internal fire risk and their potentialto affect equipment that could initiate or mitigate a plant transient.

Using the documents listed in the attachment, the inspectors reviewed whether fire hoses and extinguishers were in their designated locations and available for immediate use; that fire detectors and sprinklers were unobstructed; that transient material loading was within the analyzed limits; and that fire doors, dampers, and penetration seals appeared to be in satisfactory condition.

The inspectors also reviewed whether issues identified during the inspection were entered into the licensee's CAP.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of five quarterly fire protection inspection samples as defined in NRC lnspection Procedure 71111.05.Findinqs No findings were identified.

Flood Protection Measures (71111.06 - 1 sample)1R06.1 Internal Floodinq Review

a. Inspection Scope

The inspectors reviewed the UFSAR, the site flooding analysis, and plant procedures to assess susceptibilities involving internal flooding; reviewed the CAP to determine if the licensee identified and corrected flooding problems; and verified whether operator actions for coping with flooding are adequate.

The inspectors also focused on the 480 volt switchgear room to verify the adequacy of equipment seals located below the flood line, floor and wall penetration seals, watertight door seals, common drain lines and sumps, sump pumps, level alarms, and control circuits, and temporcry ot removable flood barriers.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one internal flood protection measures inspection sample as defined in NRC Inspection Procedure 71111.06.Enclosure b.12 Findinqs No findings were identified.

Cables Located in Underqround Manholes Inspection Inspection Scope The inspectors performed an inspection of underground Manhole 21, which contains safety related electrical cabling to the service water pumps (SWPs). The inspectors reviewed the UFSAR and related design basis documents to identify the requirements for the manhole design. The inspectors assessed the material condition of the support trays and cable insulation to verify there was no evidence of conditions that could challenge operability of the safety related pumps. The inspectors reviewed whether adverse conditions discovered during the manhole inspection, if applicable, were entered into Entergy's CAP.Specific documents reviewed during this inspection are listed in the attachment.

This inspection completed the inspection requirement for two manhole inspections in accordance with NRC inspection procedure 71111.06.

The first inspection of a manhole was documented previously in NRC lR 0500024712010003.

Findinqs No findings were identified.

1R07 Heat Sink Performance

(71111.07A - 1 sample)a. Inspection Scope The inspectors reviewed the 22EDGjacket water heat exchanger to determine its readiness and availability to perform its safety functions.

The inspectors reviewed the design basis for the component and Entergy's commitments to NRC Generic Letter 89-13. The inspectors reviewed the results of previous inspections of the 22 EDG jacket water and similar heat exchangers.

The inspectors discussed the results of the most recent inspection performed on October 12,2010 with engineering, and reviewed pictures of the as-found and as-left conditions.

The inspectors reviewed whether appropriate corrective actions were initiated for deficiencies identified by Entergy personnel.

The inspectors also reviewed whether the number of tubes plugged within the heat exchanger did not exceed the maximum amount allowed by design.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one heat sink performance inspection sample as defined in NRC Inspection Procedure 71111.07A.

b. Findinqs No findings were identified.

.2 a.Enclosure

13 1R1 1 Licensed Operator Requalification Proqram.1 Quarterlv Review (71111.11Q - 1 sample)a. Inspection Scope On October 13,2010, the inspectors observed a crew of licensed operators, responding to a simulated event involving a steam generator tube leak leading to a steam generator tube rupture and the failure of select components.

The inspectors observed the scenario in the plant simulator to verify that operator performance was adequate, evaluators were identifying and documenting crew performance problems, and that training was being conducted in accordance with licensee procedures.

The inspectors evaluated the following areas regarding crew and operator performance:

o Cladty and formality of communications;. lmplementation of timely actions;o Prioritization, evaluation, and verification of annunciator alarms;. Usage and implementation of abnormal and emergency procedures; o Control board operations;. ldentification and implementation of TS actions and emergency plan actions and notifications:

and. Oversight and direction from control room supervisors.

The inspectors compared the crew's performance in these areas to critical task completion requirements.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one quarterly licensed operator requalification program sample as defined in NRC Inspection Procedure 71111.11.b. Findinqs No findings were identified.

.2 Licensed Operator Requalification

(71111.118 r 1 sample)a. Inspection Scope The following inspection activities were performed using NUREG-1021, "Operator Licensing Examination Standards for Power Reactors;" and lnspection Procedure 71111.11, "Licensed Operator Requalification Program," Appendix A, "Checklist for Evaluating Facility Testing Material," and Appendix B, "Suggested Interview Topics." The NRC region-based inspectors conducted a review of recent operating history documentation found in inspection reports, licensee event reports, CAP, and the most recent NRC plant issues matrix. The inspectors also reviewed specific events from Entergy's CAP which indicated possible training deficiencies, to review whether they had been addressed appropriately.

The NRC senior resident inspector was also consulted for insights regarding licensed operators' performance.

These reviews did not detect Enclosure 14 any operational events that were indicative of possible training deficiencies.

The operating tests for three weeks of the exam cycle (Teams 2A, 28, and 2C) were reviewed for quality and performance.

On December 9, 2010, the results of the annual operating tests for year 2010 and the written exam for 2009 were reviewed to ensure pass fail rates were consistent with the guidance of NUREG-1021, "Operator Licensing Examination Standards for Power Reactors," and IMC 0609, Appendix l, "Operator Requalification Human Performance Significance Determination Process." The review verified the following:. Crew pass rates were greater than B0% (Pass rate was 100%);. Individual pass rates on the biennial written exam (administered in 2009) were greater than 80% (Pass rate was 100%);. Individual pass rates on the job performance measures of the operating exam were greater than 80% (Pass rate was 97.35o/o);

and. More lhan 75o/o of the individuals passed all portions of the exam (94.7% of the individuals passed all portions of the examination).

NRC observations were made on the dynamic simulator exams and job performance measures (JPM) administered during the week of September 27,2010. These observations included facility evaluations of crew and individual performance during the dynamic simulator exams and individual performance of five JPMs. Nine remediation plans for crew/individual failures were reviewed to assess the effectiveness of the remedial training.

Five license activation records were reviewed to ensure that 10 CFR 55.53 license conditions and applicable program requirements were met.Operators, instructors, and training/operation's management were interviewed for feedback on their training program and the quality of training received.

Simulator performance and fidelity were reviewed for conformance to the reference plant control room. A sample of records for requalification training attendance, program feedback, reporting, and medical examinations were reviewed for compliance with license conditions, including NRC regulations.

b. Findinqs No findings were identified.

1R12 Maintenance

Effectiveness (71111.12Q - 4 samples)a. Inspection Scope The inspectors reviewed the following areas to assess the effectiveness of maintenance activities on system performance and reliability.

The inspectors reviewed, when applicable, system health reports, CAP documents, maintenance work orders, and maintenance rule basis documents to ensure performance problems were being identified and properly evaluated within the scope of the maintenance rule. For each sample selected, the inspectors reviewed whether the structure, system, and component (SSC) was properly scoped into the maintenance rule in accordance with 10 CFR 50.65 and reviewed whether the (a)(2) performance criteria established by Entergy staff were Enclosure 15 appropriate.

For SSCs classified as (a)(1), the inspectors assessed the adequacy of goals and corrective actions to return these SSCs to (a)(2). Additionally, the inspectors determined if Entergy staff was identifying and addressing common cause failures that occurred within and across maintenance rule system boundaries.. 21 reactor coolant pump high bearing temperatures;. Central control room fan trips;. Containment isolation valves pressure control valves (PCVs) 1 191 and 1 192 failures;and. Main steam bypass valve MS-55D.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of four quarterly maintenance effectiveness samples as defined in NRC Inspection Procedure 71111.12.b. Findinqs No findings were identified.

1R13 Maintenance

RiskAssessments and EmerqentWork Control (71111.13-5 samples)a. Inspection Scope The inspectors reviewed station evaluation and management of plant risk for the maintenance and emergent work activities affecting risk significant and safety related equipment listed below to verify that the appropriate risk assessments were performed prior to removing equipment for work:. October 13, 2Q10, elevated risk due to 22 EDG planned maintenance, and 21 SWP and the station auxiliary transformer tap changer out for unplanned maintenance;. October 14,2Q10, elevated risk due to 26 isophase fan and 480 volt undervoltage alarm testing, and 2l SWP and 21 primary water pump out of service for unplanned maintenance;. November 4,2010, elevated risk due to 23 charging pump and 25 SWP out of service for unplanned maintenance; r November 14,2010, elevated shutdown risk during restoration of electrical feeder 96952; and o December 1, 2Q10, elevated risk due to 22 auxiliary boiler feed pump out of service for planned testing and severe weather.The inspectors selected these activities based on potential risk significance relative to the reactor safety cornerstones.

As applicable for each activity, the inspectors verified that Entergy personnel performed risk assessments as required by 10 CFR 50.65(aX4)and that the assessments were accurate and complete.

When Entergy personnel performed unplanned or emergent work, the inspectors verified that operations personnel promptly assessed and managed plant risk. The inspectors reviewed the scope of maintenance work and discussed the results of the assessment with the station's probabilistic risk analyst or shift technical advisor, to verify plant conditions were consistent with the risk assessment.

The inspectors also reviewed the TS requirements 16 and inspected portions of redundant safety systems, when applicable, to verify risk analysis assumptions were valid and applicable requirements were met.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of five maintenance risk assessments and emergent work control inspection samples as defined in NRC Inspection Procedure 71111.13.b. Findinqs No findings were identified.

1R15 Operabilitv

Evaluations (71111.15 - 3 samples)a. Inspection Scope The inspectors reviewed the following issues:. September 4, 2010, impact on containment sump from items found inside containment;. September 23, 2010, scaffold impact on 25 SWP piping; and. October 12,2010, EDGs heat exchanger thermal relief valves SWN-63.The inspectors selected these potential operability issues based on the risk significance of the associated components and systems. The inspectors evaluated the technical adequacy of the evaluations to assess whether TS operability was properly justified and the subject component or system remained available such that no unrecognized increase in risk occurred.

The inspectors compared the operability and design criteria in the appropriate sections of the TSs and UFSAR to Entergy's evaluations to determine whether the components or systems were operable.

Where compensatory measures were required to maintain operability, the inspectors determined whether the measures in place would function as intended and were properly controlled.

The inspectors determined, where appropriate, compliance with bounding limitations associated with the evaluations.

Additionally, the inspectors also reviewed a sampling of corrective action documents to verify that Entergy personnelwere identifying and correcting any deficiencies associated with operability evaluations.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of three operability evaluations inspection samples as defined in NRC Inspection Procedure 71111.15.b. Findinqs No findings were identified.

17 1R18 Plant Modifications (71111.18 - 1 sample)Tem porarv Mod ifications

a. Inspection Scope

The inspectors reviewed the following temporary modification to verify that the safety functions of affected safety systems were not degraded: On October 10,2010, Entergy staff implemented WO 247503 / 2-TOP-016 on 22EDG to determine the number of successive starts available with the starting air receiver at 250 psig, and determine the minimum air start pressure for a single diesel start.The inspectors reviewed the temporary modification and the associated safety evaluation screening against the system design bases documentation, including the UFSAR and the TSs, to verify that the modification did not adversely affect the system operability/availability.

The inspectors also reviewed whether the installation and restoration were consistent with the modification documents and that configuration control was adequate.

Additionally, the inspectors reviewed whether the temporary modification was identified on control room drawings, appropriate tags were placed on the affected equipment, and Entergy personnel evaluated the combined effects on mitigating systems and the integrity of radiological barriers.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one sample for temporary plant modifications as defined in NRC lnspection Procedure 71111.18.b. Findinqs No findings were identified.

1 R19 PostMaintenance Testinq (71111.19 - 6 samples)a. Inspection Scope The inspectors reviewed the following post-maintenance tests (PMTs)to verify that procedures and test activities were adequate to ensure system operability and functional capability:. October 8,2Q10, Appendix R DG after jacket water leak repair;o October 13, 2010,22 EDG after maintenance;. October 27,2010, 21 SWP after motor replacement;. October 29,2Q10, 24 SWP 480 volt breaker after maintenance;. November 2, 2010, 21 SlG level channel 'C' after repairs for failing off scale low; and. November 10, 2010, Wide range effluent radiation monitor R-27 after maintenance.

The inspectors selected these activities based upon the structure, system, or component's ability to affect risk. The inspectors evaluated these activities to determine (as applicable)the effect of testing on the plant had been adequately addressed; testing was adequate for the maintenance performed; acceptance criteria were clear and Enclosure 18 demonstrated operational readiness; and that test instrumentation was appropriate.

The inspectors evaluated the activities against the TSs, the UFSAR, licensee procedures, and various NRC generic communications to ensure that the test results adequately ensured that the equipment met the licensing basis and design requirements.

In addition, the inspectors reviewed corrective action documents associated with PMTs to determine whether Entergy personnelwere identifying problems and entering them in the CAP and that the problems were being corrected commensurate with their importance to safety.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of six PMT inspection samples as defined in NRC f nspection Procedure 71111.19.Findinos Inadequate Compensatorv Measures for Out-of-Service Plant Vent Process Radiation Monitgt lntroduction.

The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q), because Entergy staff did not implement adequate compensatory measures when the R-27 plant vent process radiation monitor, which is used for emergency action level (EAL) classification, was taken out of service.Specifically, between October 25,2010 and November 24,2010, the R-27 monitor was out of service for repair following preventive maintenance with inadequate compensatory measures.Description.

On October 25,2010, Entergy personnel removed the R-27 plant vent process radiation monitor from service for a two year preventive maintenance (PM)activity.

The R-27 monitor is used by operators in the emergency plan for identifying a radiological release and making EAL declarations and is listed in the Technical Requirements Manual (TRM) for post accident monitoring.

Entergy operators entered TRM action statement 3.3.G, which requires R-27 restoration to operable status within seven days. The PM activity was delayed because a part needed for replacement was not readily available.

On November 1 , 2010, the seven-day TRM action statement was exceeded, for which the required actions were to initiate an alternative method of monitoring the appropriate parameters and prepare a corrective action program report in 14 days. Entergy personnel established a compensatory measure by utilizing the R-44 plant vent radiation monitor which also monitors plant vent flow.On November 2,2010, the inspectors questioned the station's use of R-44 to compensate for the R-27, because the R-44 process radiation monitor has a lower indicating range and would only support declaring an Unusual Event and not higher EAL classifications.

The inspectors concluded Entergy personnel had not identified this limitation of the R-44 monitor. Entergy procedure lP-EP-AD40, "Equipment lmportant to Emergency Response," provides compensatory measures when R-27 monitor is unavailable, for both the monitor's roles of radiological release identification (including EAL thresholds)and dose assessment.

For the release identification, the procedure directed operators to perform manual sampling in accordance with the unit's TS.However, as a result of further inspector questions, Entergy staff determined this information had been removed from the TS. The inspectors determined that a number Enclosure 19 of instruments used for EP functions listed in procedure IP-EP-AD4O also had the TS referenced as an alternative measure for their use.Following the inspectors' initial questioning, EP department personnel provided the operators contingency guidance to be implemented when the R-27 monitor is out of service. This guidance implemented procedures lP-EP-310, "Dose Assessment," and IP-EP-1 15, "Emergency Plan Forms," using remotely installed radiation monitors or hand-held teletectors, and mathematical conversion equations, to provide plant vent release information.

The inspectors questioned whether Entergy personnel could verify that Site Area Emergency or General Emergency area dose rates would allow for manual measurement of the plant vent dose rates. Entergy personnel subsequently affirmed that the process was implementable under all design-basis conditions and issued appropriate direction to the operating crews in an interim guidance document on November 24,2010. Entergy personnel documented the need for interim guidance when the R-27 monitor is out of service in CR-!P2-2Q10-06718, and the need to revise procedure lP-EP-AD40 to update the alternative measures for instrumentation needed for EAL actions in CR-lP2-2010-06721.

The inspectors determined that not having R-27 monitor radiation readings available for event classification, without adequate compensatory measures, was a failure to maintain the requirements of the IPEC Emergency Plan. The inspectors determined the final version of the interim guidance for operations personnel was adequate.

The inspectors determined that the IPEC EAL scheme has redundant EALs based on the status of fission product barriers, the failure of reactor fuel, and the condition of the main containment, that would result in equivalent classifications for postulated accident events above an Unusual Event level. The inspectors determined these capabilities provided assurance that any delay in obtaining plant vent process radiation monitor readings by manual methods when the R-27 monitor was unavailable would not have affected the outcome of protecting the health and safety of the public or of station personnel.

Analvsis.

The performance deficiency associated with this finding was that Entergy personnel did not provide adequate compensatory measures for when the R-27 plant vent monitor was removed from service. This finding is more than minor because it was associated with the ERO attribute of the EP Cornerstone and affected the cornerstone objective to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

In accordance with Inspection Manual Chapter (lMC) 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding was of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.4 and Sheet 1, "Failure to Comply," and determined that the failure to comply with an aspect of the Emergency Plan related to event classification (10 CFR 50.47(bX4))

was a RSPS problem; but it was not a RSPS functional failure of the IPEC event classification process. The inability to determine the release rate through the main stack plant vent when the R-27 monitor was out of service was a failure to comply with the regulations; however, redundant EALs in the IPEC Unit 2 EAL would have resulted in equivalent classifications for postulated accident events above an Unusual Event level. These capabilities provided assurance that this performance deficiency ultimately would not have affected the outcome of protecting the health and safety of the public or of station personnel.

20 This finding has a cross-cutting aspect in the area of problem identification and resolution associated with the corrective action program attribute of taking appropriate corrective actions to address safety issues in a timely manner. Specifically, Entergy staff did not provide for appropriate emergency planning compensatory corrective actions when the R-27 monitor was removed from service. tP.1(d) per IMC 03101 Enforcemerf.t.

10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part, that a licensee "shall follow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX4)requires, in part, that "a standard emergency classification and action level scheme, the bases of which include facility system and effluent parameters, is in use by the nuclear facility licensee." Contrary to the above, from October 25,2010 to November 24,2010, Entergy personnel did not have an adequate method or equipment in place, under certain accident conditions, for identifying and classifying an offsite release through the plant main vent when the R-27 monitor was out of service. As a result, this condition could have resulted in an unnecessary delay in identifying plant vent releases that would have resulted in the declaration of an emergency event above the Unusual Event level. By failing to meet the requirements of 10 CFR 50.47(bX4), Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan.Entergy personnel corrected this deficiency by issuing adequate guidance to the Unit 2 operating crews when the R-27 monitor was removed from service. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR-IP2-2010-06721, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 00500024712010005-01, Inadequate Compensatory Measures for Out-of-Service Plant Vent Process Radiation Monitor.

1R20 Refuelino

and Outaqe Activities (71111.20 - 1 sample)a. Inspection Scope The inspectors reviewed the outage safety plan and contingency plans for the Unit 2 unplanned maintenance outage to replace the 21 main transformer, conducted November 7 - 23,2010. The inspectors'review considered whether Entergy personnel appropriately considered risk, industry experience, and previous site performance in developing and implementing a plan that assured maintenance of defense in depth with regards to reactor safety. During the maintenance outage, the inspectors observed portions of the shutdown and cooldown processes and monitored Entergy operator controls over the outage activities listed below:. Configuration management, including maintenance of defense in depth, commensurate with the outage safety plan for key safety functions and compliance with the applicable TSs when taking equipment out of service;r Clearance activities, including confirmation that tags were properly hung and equipment appropriately configured to safely support the work or testing;. Status and configuration of electrical systems to ensure that TSs and outage planning requirements were met, and controls over switchyard activities were appropriate; o Monitoring of decay heat removal processes, systems, and components; 21 r Controls over activities that could affect reactivity;. Maintenance of secondary containment as required by the TS;r Startup and ascension to full power operation, tracking of startup prerequisites;. Station personnel identification and resolution of problems related to maintenance outage activities; and. Work hours for fatigue concerns.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one other outage inspection sample as defined in NRC lnspection Procedure 7 1111

.20. b. Findinqs No findings were identified.

1R22 Surveillance

Testinq (71111.22 - 5 samples)a. Inspection Scope The inspectors observed performance of surveillance tests andior reviewed test data of selected risk significant SSCs, to assess whether test results satisfied TSs, UFSAR, technical requirements manual (TRM), and Entergy procedure requirements.

The inspectors verified that test acceptance criteria were sufficiently clear; tests demonstrated operational readiness and were consistent with design basis documentation; test instrumentation had accurate calibrations and appropriate range and accuracy for the application; tests were performed as written; and applicable test prerequisites were satisfied.

Following the tests, the inspectors considered whether the test results supported conclusions that equipment was capable of performing the required safety functions.

The following surveillance tests were reviewed:. September 1, 2010, 2-PT-Q017C, alternate safe shutdown supply verification to 23 component cooling water pump;. September 12, 2010, 2-OSP-4.1.2, support procedure - component cooling system operation; r October 18,2010, 2-PT-Q028A,21 residual heat removal pump test;. October 1 8,2010, 2-PT-Q013, data sheet 43,22 safety injection (Sl) pump tie to 21 Sl pump discharge valve in-service valve test; and. December 17,2010, reactor coolant system (RCS) leak rate surveillance test.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of five surveillance testing inspection samples as defined in NRC Inspection Procedure 71111.22.b. Findinqs No findings were identified.

22 Cornerstone:

Emergency Preparedness (EP)lEPO Drill Evaluation (71114.06 - 1 sample)a. Inspection Scope The inspectors evaluated operator performance during a simulator scenario conducted on October 13,2Q10, to identify any weaknesses and deficiencies in classification, notification, and protective action recommendation development activities.

The inspectors observed emergency response operations in the simulator to determine whether the event classification, notifications, and protective action recommendations were performed in accordance with procedures.

The inspectors also attended the station drill critique to compare inspector observations with those identified by Entergy staff in order to evaluate Entergy's critique and to verify whether the Entergy staff was properly identifying weaknesses and entering them into the CAP.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one sample as defined in NRC lnspection Procedure 71114.06.b. Findinqs No findings were identified.

2. RADIATION

SAFEW Cornerstone:

Occupational/Public Radiation Safety (PS)2RS1 Radioloqical Hazard Assessment and Exposure Controls (71124.01*

1 sample)a. lnspection Scope Inspection Planning The inspectors reviewed all licensee performance indicators (Pls) for the Occupational Exposure cornerstone for follow up and reviewed the results of the most recent radiation protection program audit.Contamination and Radioactive Material Control The inspectors selected three sealed sources from the licensee's inventory records, verified that the sources were accounted for, and have been leak tested within the past six months. The inspectors verified that there have not been any source transfer transactions since the last inspection involving nationally tracked sources.Radioloqical Hazards Control and Work Coverare During tours of the facility and review of ongoing work, the inspectors evaluated ambient radiological conditions, verified that existing conditions were consistent with posted suryeys, RWPs, and worker briefings, as applicable.

During available job performance observations, the inspectors verified the adequacy of radiological controls, radiation Enclosure 23 protection job coverage, contamination controls, and evaluated the licensee's use of electronic pocket dosimeters in high noise areas. The inspectors verified that dosimeters of legal record were being placed on the individual's body consistent with monitoring the highest expected dose due to external radiation sources.During this inspection, there were no active work activities within airborne radioactivity areas with the potentialfor individual worker internal exposures for evaluation.

The inspectors examined the licensee's physical and programmatic controls for highly activated or contaminated materials (nonfuel)stored within spent fuel and other storage pools and verified that appropriate controls were in place to preclude inadvertent removal of these materials from the pools. The inspectors conducted selective inspection of posting and physical controls for high radiation areas (HRAs) and very high radiation areas (VHRAs) to verify conformance with TS and procedural requirements.

Risk Siqnificant Hiqh Radiation Area and Verv Hiqh Radiation Area Controls The inspectors reviewed the controls and procedures for high risk HRAs and VHRAS.The inspectors verified that any changes to licensee procedures did not substantially reduce the effectiveness and level of worker protection.

The inspectors discussed with a health physics supervisor the controls in place for special areas that have the potential to become VHRAs during certain plant operations to determine if these plant operations include prior communication with the HP organization to allow for timely actions to properly post, control, and monitor the radiation hazards including re-access authorization.

Radiation Worker Performance During job performance observations, the inspectors observed radiation worker performance with respect to radiation work permit requirements to determine if workers are aware of the radiological conditions in their workplace and if their work performance reflects the conditions of the radiation work permit requirements.

The inspectors reviewed several radiological problem reports since the last inspection that include the cause of the event to be attributable to human performance errors. This review included a determination of any similar observable patterns and effectiveness review of any prior corrective actions taken by the licensee to resolve any similar prior radiological problems.Radiation Protection Technician Proficiencv During job performance obseryations, the inspectors observed the performance of radiation protection technicians with respect to applicable radiation work permit requirements to determine if technicians were aware of the radiological conditions in their workplace, the RWP controls/limits in place and if their performance was consistent with their training and qualifications with respect to the radiological hazards and work activities.

The inspectors reviewed several radiological problem reports since the last inspection that include the cause of the event to be attributable to radiation protection technician error. This review included a determination of any similar observable patterns and effectiveness review of any prior corrective actions taken by the licensee to resolve any similar prior radiological problems.Enclosure b.a.2RS2 24 Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one sample as defined in NRC Inspection Procedure 71124.01.Findinqs No findings were identified.

OccupationalALARA Planninq and Controls (71124.02 - 1 sample)Inspection Scope Inspection Plannino The inspectors reviewed site procedures associated with maintaining occupational exposures ALARA, including a review of processes used to estimate and track exposures from specific work activities.

Radioloqical Work Planninq Based on radiation work permit outage work activity collective exposure results from the Unit 2 Spring 2010 refueling outage, the inspectors selected for review those work activities that resulted in a dose of 5 person-rem or greater. This review included the basis of the exposure estimates with reference to historical performance metrics, and exposure mitigation requirements planned for these outage tasks.With respect to the outage work activity samples, the inspectors compared the actual exposure results with the estimated exposure established in the licensee's ALAM plans for these work activities.

The inspectors also compared the person-hour estimates provided by maintenance planning and other groups to the radiation protection group with the work activity person-hour actual results, to evaluate the performance results.The inspectors determined the reasons (e.9., failure to adequately plan the activity, failure to provide sufficient work controls)for any inconsistencies between intended and actual work activity doses. The inspectors also determined if any identified exposure overrun causes were identified and entered into Entergy's CAP.Verification of Dose Estimates and Exposure Trackinq Svstems The Unit 2 Spring refueling outage ALARA work packages that resulted in greater than 5 person-rem were reviewed to include the assumptions and basis (including dose rate and man-hour estimates)for their collective exposure estimates.

Applicable procedures were reviewed to determine the methodology for estimating exposures for specific work activities and determining the intended dose outcome.The inspectors verified for the selected work activities that the licensee has established measures to track, trend, and if necessary to reduce, occupational doses for ongoing work activities and that criteria are established to prompt additional reviews and/or additionalALARA planning and controls.

The inspectors evaluated the licensee's method of adjusting exposure estimates when unexpected changes in scope or emergent work were encountered.

The inspectors determined if adjustments to Enclosure b..1 25 exposure estimates (intended dose)were based on sound radiation protection and ALARA principles or if they were only adjusted to account for failures to control the work.Source TeJn Reduction and Control Through a review of licensee records, the inspectors evaluated the historical trends and current status of significant tracked plant source terms known to contribute to elevated facility aggregate exposure and reviewed the licensee's contingency plans for expected changes in the source term as the result of changes in plant fuel performance issues or changes in plant primary chemistry.

Radiation Worker Performance The inspectors observed radiation worker and radiation protection technician performance during work activities being performed in radiation areas and high radiation areas. The inspectors determined if workers demonstrated the ALARA philosophy in practice and whether there were any procedure compliance issues and whether the training and skill level of the radiation workers was sufficient with respect to the radiological hazards and the work tasks involved.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one sample as defined in NRC Inspection Procedure 71124.02.Findings Inadequate Work Planninq Control Relative to_Beqenerative Heat E4ghanqer Permanen!Shieldinq Modiflgation That Resulted jn Additional Unplanned Collective Exposule lntroduction.

A Green self-revealing finding was identified because Entergy personnel did not adequately plan and control work activities related to a regenerative heat exchanger permanent shielding modification in accordance with RWP 20102537, "2R19 Permanent Regenerative Heat Exchanger Shielding" which resulted in significant unplanned exposure.Desplription.

During Refueling Outage 19, Entergy's RWP 20102537 provided the ALARA plan and dose estimate standard for the regenerative heat exchanger permanent shielding modification.

The regenerative heat exchanger permanent shielding modification dose exceeded the planned dose estimate in RWP 20102537.

Entergy personnel determined the dose estimates were exceeded due to inadequate work activity planning and control. The lack of in-field walkdowns prior to designing the modification resulted in as-found interferences, and due to limited field supervision, the resulting construction modification was performed in a posted high radiation area. ln addition, the construction workers performing the work did not have an assigned project lead to direct the in-field work, which resulted in delays in completing the modification within time estimates as assumed in the dose planning.

These factors resulted in additional collective exposure that Entergy could have reasonably avoided had sufficient work activity planning and additional in-field supervision occurred.The inspectors reviewed RWP 20102537 and determined the actualjob site conditions for installation of the regenerative heat exchanger permanent shielding were not Enclosure 26 adequately evaluated for interferences and when revealed, measures were not taken by Entergy personnel to prefabricate the modifications outside of a high radiation area, resulting in additional unnecessary personnel exposure.

The original exposure work estimate was 6.8 person-rem.

In order to provide allowance for higher dose rates than anticipated, the original estimate was increased to 8.0 person-rem, however the actual work activity exposure was 17

.189 person-rem

(115To greater than the revised exposure estimate).

This issue was entered into Entergy's CAP as CR-IP2-2010-02817.

Analvsis.

The performance deficiency associated with this finding was that Entergy personnel did not adequately plan and controlwork activities related to a regenerative heat exchanger permanent shielding modification in accordance with RWP 20102537.This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.

lt is also similar to the more than minor example 6,j provided in IMC 0612, "Power Reactor lnspection Reports," Appendix E, "Examples of Minor lssues," since it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an ALARA planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007-2009).

The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy's planned work activities did not adequately incorporate the job site interferences and their resolution in accordance radiological safety. H.3(a) per IMC 0310]Enforcement.

This finding does not involve enforcement action because no regulatory requirement violation was identified.

Because this finding does not involve a violation, has very low safety significance, and was entered into Entergy's CAP as CR-lP2-2010-02817, it is identified as a finding: FIN 0500024712010005-02, Inadequate Work Planning Gontrol Retative to Regenerative Heat Exchanger Permanent Shielding Modification That Resulted in Additional Unplanned Gollective Exposure.lnadequate Work Coordination Relative to Reactor Cavitv Liner Repair That Resulted in Additional Unplanned Collg;tive Expg.sure

Introduction.

A Green self-revealing finding was identified because Entergy personnel did not adequately plan and controlwork activities related to reactor cavity liner repair in accordance with RWP 20102530, "2R19 Cavity Liner Repair" which resulted in significant unplanned collective exposure.Description.

During Refueling Outage 19, Entergy's RWP 20102530 provided the ALARA plan and dose estimate standard for the work activity.

The Unit 2 reactor cavity liner repair dose exceeded the planned dose estimate in RWP 20102530.

Entergy personnel determined the dose estimate was exceeded due to inadequate work coordination and ALARA plan implementation.

Schedule delays resulted in the intended.2 Enclosure 27 contractor vendor not being able to conduct the work as planned, resulting in the use of back-up workers to perform the cavity sealant removalwork, which resulted in additional person-hours to complete this work. Also due to schedule delays, the reactor head shielding was removed while the cavity liner repair work was still in progress, which resulted in higher than planned exposures.

In addition, due to the delayed and compressed schedule, the planned shielding for the cavity boring work was not applied as planned, which resulted in higher exposures.

The inspectors reviewed RWP 20102530 and determined the additional person-hours to perform the reactor cavity sealant removal, the removal of reactor head shielding, and failure to provide the planned cavity boring shielding resulted in additional collective exposure that could have been avoided had sufficient work coordination and work plan implementation been performed.

The original exposure work estimate was 3.09 person-rem. For purposes of this analysis, in order to provide allowance for higher dose rates than anticipated, the original estimate was increased to 3.635 person-rem.

When compared to the actual work activity exposure of 7.058 person-rem, the results were 94% greater than the revised exposure estimate.

This issue was entered into Entergy's CAP as CR-!P2-201 0-02817 .Analvsis.

The performance deficiency associated with this finding was that Entergy personnel did not adequately plan and controlwork activities related to the reactor cavity liner repair in accordance with RWP 20102530.

This finding is more than minor because it is associated with the program and process attribute of the Occupational Radiation Safety cornerstone and affected the cornerstone objective of ensuring the adequate protection of the worker health and safety from exposure to radiation from radioactive material during routine reactor operations.

lt is also similar to the more than minor example 6.j provided in IMC 0612, "Power Reactor Inspection Reports," Appendix E,"Examples of Minor lssues," since it involves an actual collective exposure greater than 5 person-rem and exceeded the planned, intended dose by more than 50%.Using IMC 0609, Appendix C, "Occupational Radiation Safety Significance Determination Process," the finding was determined to have very low safety significance (Green) because the finding involved an ALARA planning issue and the 3-year rolling average collective dose history was less than 135 person-rem (52.261 person-rem average annual exposure for 2007-2009).

The finding has a cross-cutting aspect in the area of human performance associated with the work control attribute because Entergy did not coordinate and implement work activities as planned, keeping personnel apprised of work status and schedule delays, which resulted in significant dose overrun. tH.3(b) per IMC 03101

Enforcement.

This finding does not involve enforcement action because no regulatory requirement violation was identified.

Because this finding does not involve a violation, has very low safety significance, and it was entered into Entergy's CAP as CR-IP2-2Q10-02817, it is identified as a findingr FIN 0500024712010005-03, Inadequate Work Coordination Relative to Reactor Gavity Liner Repair That Resulted in Additional Unplanned Collective Exposure.Enclosure

OTHER ACTIVITIES

4OA1 Performance

lndicator Verification (71151- 5 samples).1 Mitiqatinq Svstems Performance Index - Heat Removal Svstem (MS08)a. Inspection Scope The inspectors sampled Entergy submittals for the mitigating systems performance index - heat removal system Pl for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in Nuclear Energy lnstitute (NEl)Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed the licensee's operator narrative logs, issue reports, event reports, mitigating systems performance index derivation reports, and NRC integrated inspection reports to validate the accuracy of the submittals.

The inspectors also reviewed Entergy's issue report database to determine if any problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.

Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one mitigating systems performance index - heat removal system sample as defined in NRC lnspection Procedure 71151.A correction fo NRC lnspection Report 05000247/2010004 dated November 10, 2010: Mitigating Sysfems Performance lndex - Residual Heat Removal System (M509) was reviewed instead of Heat RemovalSysfem (M508).Findinos No findings were identified.

Mitioatinq Svstems Performance Index - Coolinq Water Svstems (MS10)lnspgction Scope The inspectors sampled Entergy submittals for the mitigating systems performance index - cooling water systems for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in NEI Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed Entergy's operator narrative logs, issue reports, event reports, mitigating systems performance index derivation reports, and NRC integrated inspection reports to validate the accuracy of the submittals.

The inspectors also reviewed Entergy's issue report database to determine if problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.

Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one mitigating systems performance index - cooling water systems sample as defined in NRC Inspection Procedure 71151..2 a.Enclosure

.3 b.a.29 Findinqs No findings were identified.

Reactor Coolant Svstem Leakaqe (8102)Inspection Scope The inspectors sampled Entergy submittals for RCS leakage Pl for the period from October 2009 through September 2010. To determine the accuracy of the Pl data reported during those periods, the inspectors used definitions and guidance contained in NEI Document 99-02, "Regulatory Assessment Performance Indicator Guideline." The inspectors reviewed the licensee's operator narrative logs, issue reports, event reports, and NRC integrated inspection reports to validate the accuracy of the submittals.

The inspectors also reviewed Entergy's issue report database to determine if any problems had been identified with the Pl data collected or transmitted for this indicator and none were identified.

Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one RCS leakage sample as defined in NRC lnspection Procedure 7 1151.Findinqs No findings were identified.

Occupational Exposure Control Effectiveness Inspection Scope The inspectors reviewed implementation of Entergy's Occupational Exposure Control Effectiveness Pl Program. Specifically, the inspectors reviewed CRs, and radiological controlled area dosimeter exit logs for the past four calendar quarters (through 3rd quarter 2010). These records were reviewed for occurrences involving locked high radiation areas, very high radiation areas, and unplanned exposures against the criteria specified in NEI 99-02, "Regulatory Assessment Performance Indicator Guideline," to verify that all occurrences that met the NEI criteria were identified and reported as Pls.Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one occupational exposure control effectiveness sample as defined in NRC Inspection Procedure 71151.Findinos No findings were identified.

b..4 b.Enclosure

.5 30 Radioloqical

Effluent Technical Specification (RETS)/Offsite Dose Calculglion Manual (ODCM) Radioloqical Effluent Opcurrences Inspection Scope The inspectors reviewed a listing of relevant effluent release reports for the past four (4)calendar quarters (through 3rd quarter 2010), for issues related to the public radiation safety Pl, which measures radiological effluent release occurrences per site that exceed 1,5 mrem/quarter whole body or 5.0 mrem/quarter organ dose for liquid effluents; 5 mrads/quarter gamma air dose, 10 mrad/quarter beta air dose, and 7.5 mrads/quarter for organ dose for gaseous effluents.

The review was against applicable criteria specified in NEI 99-02, "Regulatory Assessment Performance Indicator Guideline." The purpose of the review was to verify that occurrences that met the NEI criteria were recognized and identified as Pl occurrences.

The inspectors reviewed the following documents to ensure the licensee met all requirements of the Pl:. Monthly prolected dose assessment results due to radioactive liquid and gaseous effluent releases;. Quarterly projected dose assessment results due to radioactive liquid and gaseous effluent releases; and. Dose assessment procedures.

Specific documents reviewed are described in the attachment to this report. These activities constitute completion of one RETS/ODCM radiological effluent occurrences sample as defined in NRC Inspection Procedure 71151.Findinqs No findings were identified.

ldentification and Resolution of Problems (71152 - 2 samples)Routine Review of Problem ldentification and Resolution Activities Inspection Scope As required by Inspection Procedure7l152, "ldentification and Resolution of Problems," the inspectors routinely reviewed issues during baseline inspection activities and plant status reviews to verify that issues were being entered into Entergy's CAP at an appropriate threshold, that adequate attention was being given to timely corrective actions, and that adverse trends were identified and addressed.

In order to assist with the identification of repetitive equipment failures and specific human performance issues for follow-up, the inspectors performed a daily screening of items entered into the CAP.The inspectors reviewed attributes that included:

(1) complete and accurate identification of the problem; (2) timely correction, commensurate with the safety significance; (3)evaluation and disposition of performance issues, generic implications, common causes, contributing factors, root causes, extent of condition reviews, and previous occurrences reviews; and (4) classification, prioritization, focus, and timeliness of corrective actions.These routine reviews for the identification and resolution of problems did not constitute any additional inspection samples. Instead, by procedure, they were considered an b.4c.42.1 a.Enclosure b.a..2 31 integral part of the inspections performed during the quarter. Specific documents reviewed during this inspection are listed in the attachment.

Findinqs No findings were identified.

Semi-Annual Trgnd Review Inspection Scope The inspectors performed a semi-annual review of site issues, to identify trends that might indicate the existence of more significant safety issues, as required by Inspection Procedure 7l152, "ldentification and Resolution of Problems." The inspectors included in this review, repetitive or closely related issues that may have been documented by Entergy outside of the CAP, such as trend reports, Pls, major equipment problem lists, system health reports, maintenance rule assessments, and maintenance or CAP backlogs.

The inspectors also reviewed the Entergy CAP database for the first and second quarters o12010, to assess CRs written in various subject areas (equipment problems, human performance issues), as well as individual issues identified during the NRCs daily CR review (Section 4OA2.1). The inspectors reviewed the Entergy quarterly trend report for the first quarter of 2010, conducted under LO-IP3LO-2010-00049 to verify that Entergy personnelwere appropriately evaluating and trending adverse conditions in accordance with applicable procedures.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one in-depth problem identification and resolution sample as defined in NRC Inspection Procedure 71152.Findinqs and Observations No findings of significance were identified.

The inspectors evaluated a sample of departments that are required to provide input into the quarterly trend reports, which included system engineering and operations departments.

This review included a sample of issues and events that occurred over the course of the past two quarters to objectively determine whether issues either were appropriately considered or ruled as emerging or adverse trends, and in some cases, verified the appropriate disposition of resolved trends. The inspectors verified that these issues were addressed within the scope of the CAP, or through department review and documentation in the quarterly trend report for overall assessment.

For example, the inspectors noted that consistent with an increase in the human performance error rate that Entergy personnel had appropriately identified "human performance error rate" as a monitored trend with ongoing corrective actions to address this long-standing issue. In other cases, the inspectors verified for resolved trends, such as vital area door hardware deficiencies, that applicable success criteria were identified to ensure successful resolution of adverse trends.Additionally, the inspectors noted an apparent increase in the CRs associated with the decreasing pressure in the Sl tanks, and while a sample review indicated Entergy plans further troubleshooting of this issue, the cause of the decreasing pressure has not been b.Enclosure

.3 a.32 identified.

The inspectors reviewed the trend and determined Entergy personnel had appropriately developed WOs to troubleshoot this issue and no current operability issue existed because Sl tank pressure was within the required band.The inspectors also observed an apparent increase in the number of inadequacies with operability determinations.

The inspectors noted some operability determinations included insufficient detail to prove operability of safety-related components without further discussions with operations and engineering personnel.

For example, CR-IP2-2010-05173 and CR-lP2-2010-07232 for fuel oil leaks on the 22 and 23 emergency diesel generators did not provide sufficient information to ensure adequate fuel oil was available during a design basis accident for the mission time of the diesels with these fuel oil leaks. These operability determinations were revised and addressed in common CR, CR-IP3-2A10-02576.

Also, CR-lP2-2010-05378 for a 23 battery charger ground did not provide an operability determination until questioned by the inspectors.

An operability determination was performed to ensure the 23 battery charger would perform as designed with these grounds. Since no equipment was actually inoperable, and there was no appreciable reduction in safety margin, these issues are considered minor. The inspectors noted that these inadequate operability determinations had not been recognized by Entergy staff as a specific emerging or adverse trend.Annual Sample - Aqqreqate lmpact of Operator Workaroqnds lnspection Scope The inspectors conducted a review of the aggregate impact of operator burdens and workarounds.

The inspectors reviewed Entergy's implementation of procedures OAP-45, "Qperator Burden Program." The inspectors conducted control room walkdowns and interviewed plant operators to determine the impact of deficiencies on operator response to plant events. Additionally, the inspectors reviewed operator logs, CRs and performed system walkdowns to verify that there were no risk significant operator actions that had not been evaluated by Entergy personnel.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one in-depth problem identification and resolution sample as defined in NRC lnspection Procedure 71152.Findinqs and Observations No findings were identified.

The inspectors verified that operator workarounds and burdens were entered into the CAP at an appropriate threshold and that corrective actions were planned or taken commensurate with their safety significance.

b.Enclosure

.4 a.33 (Closed) Unresolved

ltem 05Q9@422010-002-02, &eluelino Cavitv Leakaqe rnLo Conteinment Inspection Ssope The inspectors completed an evaluation of unresolved item (URl)0500024712010002-02 regarding historical refueling cavity leakage into containment that occurs during reactor refueling activities for approximately two weeks every other year. The URI documented that, during refueling outages from 1993 to the present, borated water (containing approximately 2700 ppm boric acid) had leaked from the reactor refueling cavity into the lowest level of containment at a rate of two to ten gallons per minute. The URI was opened because inspectors concluded additional information was required from Entergy personnel related to their assessment of this condition.

The central item discussed in the URI was that Entergy technical staff had not evaluated the impact of the borated refueling cavity water on the dissimilar metal welds between the stainless steel liner and the carbon steel studs that attach the liner to the concrete wall. ln addition, the inspectors evaluated whether the Entergy corrective action process was appropriately implemented for identifying, evaluating, and resolving this issue.The inspectors met with Entergy personnel to discuss the open item described above.Entergy personnel provided the inspectors with an engineering evaluation to address the central issue of the URI - the impact of the borated water on the liner attachment welds and carbon steel hardware.

Entergy personnel also provided the inspectors with information and documentation to address related inspector questions.

The inspectors reviewed the information provided, conducted additional meetings with Entergy personnel to determine whether Entergy technical staff had adequately provided the necessary information for the inspectors to address closure of the URl. Further details of the inspectors' review of this URI are provided below.Findinqs a[d Observations The URI documented that, during refueling outages from 1993 to the present, borated water had leaked from the reactor refueling cavity into the lowest level of containment at a rate of two to ten gallons per minute. Additional information from Entergy's CAP documented that the epoxy repairs performed in 1993 were effective, and there were no documented liner plate epoxy repair failures revealed until 2000.ln response to the URI (the impact of the borated water on the liner attachment welds and carbon steel hardware), Entergy engineering personnel performed an engineering evaluation that determined there were no structural concerns due to the leaking refueling cavity water on liner welds and hardware.

The evaluation was documented in Entergy's CAP under CR-lP2-2008-01629.

Specific data used by station personnel to reach this conclusion included the results of several core bores that were taken from concrete and reinforcing steel, visual observations of the dissimilar welds and carbon steel hardware, results of water samples taken during 2R19 showing very low levels of chlorides, and results of an EPRI study showing borated water does not aggressively attack carbon steel in the temperature range to which these components are exposed.The inspectors reviewed Entergy's evaluation and determined that Entergy personnel had adequately addressed the open item regarding the impact of the borated water on the liner attachment welds and carbon steel hardware.

Further, with respect to the b.Enclosure 34 structural integrity of the reactor cavity liner and concrete, the inspectors reviewed:

1)core samples that were taken from reactor cavity concrete structure; 2) photographs of additional core samples and imbedded rebar; and 3) the licensee and vendor evaluations including petro graphic examination of the concrete aggregate.

The inspectors also reviewed completed License Renewal actions as accepted by the NRC Staff's SER for various letters submitted by Entergy up to and including June 2009.Specifically, the following items for 2010 were reviewed and evaluated:

1) three core samples of concrete from the observed leakage location to determine the compressive strength of the concrete and pH value as well as boron and chloride concentration in concrete and water; and 2) visual examination of the exposed reinforcements.

The inspectors' independent review did not identify unusual indications or degradation of concrete and re-bar. The inspectors determined that core samples appeared as described by Entergy personnel and the water chemistry was as expected.

The inspectors also noted the proper completion of license renewal commitments with respect to concrete core samples and water chemistry analysis of 2010. Further, the inspectors reviewed the report lP-RPT-1 1-00002 regarding Entergy's conclusion that the Reactor Fueling Cavity and the Fuel Handling Building Concrete retained the structural capacity to fulfill its design and safety function.

The inspectors' review determined that Entergy's evaluation was appropriate in its evaluation and conclusion that the design and safety function of the liner was maintained given the current condition and impacts regarding the leakage that occurs during refueling outages. The inspectors also discussed Entergy's plan for the permanent fix and verified that if remediation is unsuccessful for the leakage, then Entergy's corrective action process has provisions to continue to re-inspect the concrete, re-bar, and the leaking water prior to extended operation.

As part of the inspectors' corrective action review of this condition, which included review of plant drawings, inspectors questioned the safety classification of the refueling cavity liner. Entergy staff evaluated the liner classification as documented in EC 21400.Entergy staff's EC evaluation determined that the refueling cavity liner did not meet the requirements to be classified as a safety-related component.

However, Entergy engineers determined the cavity liner met station requirements to be classified as an augmented quality (QP) component, which is an SSC that is not safety-related but may require additional quality level oversight.

The Entergy QP designation imposes formal requirements on liner design, materials, and work methods to maintain greater control over liner-related activities.

The inspectors reviewed the EC and verified Entergy personnel had followed their procedures and processes for determining the safety classification of the liner.Additionally, inspectors questioned whether the wetted SSCs were being properly addressed in accordance with procedure EN-DC-319, "lnspection and Evaluation of Boric Acid Leaks." The inspectors noted that procedure EN-DC-319 required, "For non-white, wet, or excessive leaks, a BAC [Boric Acid Corrosion]

Evaluator shall evaluate the leak using guidance established in Attachment 9.4." The inspectors noted that, contrary to this procedural reguirement, Entergy technical staff had not completed an Attachment 9.4 evaluation for the wetted components in the 46 foot level of containment.

Entergy personneldocumented this issue as CR-lP2-2010-02628 and completed Attachment 9.4. Using the EPRI Boric Acid Guidebook, engineering personnel calculated the expected corrosion rates for the given temperature range and time duration of exposure.

The evaluation determined that, due to the moderate Enclosure 35 temperatures and limited exposure time (wetting only occurs during cavity flood up, which is less than three weeks every two years), the pumps, valves, piping, associated components and their supports would not be significantly impacted by boric acid corrosion.

The inspectors reviewed Entergy's evaluation and determined that it adequately addressed the impact of the refueling cavity leakage on the equipment in the 46 foot level of containment.

In addition, the inspectors conducted several walkdowns of the 46 foot level of containment during 2R19 and verified that the SSCs were not experiencing external corrosion due to the borated water. The inspectors also ensured Entergy personnel were following procedure EN-DC-319 to review and evaluate any dry boric acid found on these components at the start of each refueling outage.The inspectors determined that not following the requirements of procedure EN-DC-319 was a performance deficiency.

Specifically, Entergy technical staff did not evaluate the wet boric acid leak on the 46 foot level of containment until questioned by the NRC. The inspectors reviewed this performance deficiency in accordance with NRC IMC 0612 Appendix B and determined that it constituted a performance deficiency of minor significance because there was no safety impact on equipment, and because Entergy engineers performed evaluations of the dry boric acid accumulated throughout the cycle at the beginning of each refueling outage.The inspectors further reviewed procedure EN-tl-102, "Corrective Action Process," Step 5.2.e, which states, "Employees are required to initiate condition reports for adverse conditions." Attachment9.2 of this procedure gives examples of adverse conditions such as "Conditions affecting a safety related, quality related or trip sensitive system caused by a deficiency in characteristic, documentation or procedure that renders the quality of an item unacceptable or indeterminate.

The inspectors reviewed procedure EN-OP-104, "Operability Determination Process," Step 5.1.5, "SSCs warrant functionality assessments within the processes used to address degraded and nonconforming conditions because they perform specified safety functions described in the UFSAR." The UFSAR Section 9.5.1.4, "Protection Against Radioactivity Release from Spent Fuel and Waste Storage," states, "The reactor cavity, refueling canal and spent fuel storage pit are reinforced concrete structures with a seam-welded stainless steel plate liner. These structures are designed to withstand the anticipated earthquake loadings as seismic Class I structures so that the liner prevents leakage even in the event the reinforced concrete develops cracks." The inspectors identified a performance deficiency because Entergy personnel did not fully implement procedures EN-Ll-102 and EN-OP-104.

Specifically, while condition reports were initiated for the leak each refueling outage when they occurred, Entergy personnel did not perform a functional assessment to evaluate the reactor cavity liner leakage each refueling outage when the condition existed. Entergy personnel initiated CR-lP2-2010-06741 and conducted a past functionality assessment.

Entergy personnel determined that the leakage condition, when present, was a condition not consistent with the reactor cavity liner's UFSAR described design function; however, Entergy personnel determined the leakage condition did not have a safety impact on the liner's functionality.

The inspectors reviewed this performance deficiency in accordance with IMC 0612 Appendix B and determined that it constituted a performance deficiency of minor significance because the non-conforming leakage condition did not have a safety impact on the equipment or the liner attachment welds and carbon steel hardware that support liner functionality.

Entergy personnel have developed a recurring step in the outage plan to write a condition report and evaluate the leaking condition, until repaired, to ensure Enclosure

.5 36 there is no impact on equipment.

This recurring task is documented in LO-OLl-2010-00140. Entergy personnel continue to implement and evaluate corrective actions (CR-lP2-2008-01629)to correct the liner leakage and restore the condition of the liner to as described in the UFSAR.ln general, based on the review of Entergy's corrective actions for the reactor cavity liner leakage condition, the inspectors concluded that Entergy personnel are following their CAP for evaluating and resolving the leakage. Entergy staff prioritized this issue commensurate with the safety significance of the problem, and for the long term corrective actions, is performing the required yearly periodic assessment.

Station personnel have been following their process for identifying and evaluating the dry boric acid residue in accordance with procedure EN-DC-319.

However, as described above, the inspectors determined that each refueling outage, site personnel did not specifically screen the leakage appropriately for liner functionality and evaluate the interim wet boric acid conditions.

The inspectors have completed their review of URI 0500024712010002-02.

Two minor performance deficiencies were identified as noted above. Specific documents reviewed during this inspection are listed in the attachment.

This URI is closed.Selected lssue Follow-up Inspection Inspection Scope An inspection was performed at the Entergy corporate office in Jackson, Mississippi on June 14 through 17 ,2010, to review the circumstances surrounding missed quality control (QC) verification inspections documented in CR-HQN-2009-01 184 and CR-HQN-2O10-00013.

The issue involved QC verification inspections performed during construction-related activities which were required as part of the Entergy quality oversight and verification programs.

The inspection was performed to determine if the licensee had taken corrective actions commensurate with the significance of the identified issues, and to assess the impact, if any, on the operability of plant equipment caused by the missed inspections.

This inspection was conducted by inspectors from Regions l, ll, and lV, as well as a Senior Program Engineer from the Quality and Vendor Branch of the Office of Nuclear Reactor Regulation (NRR). The inspection covered all NRC-licensed sites owned by Entergy Operations, lnc., including Arkansas Nuclear One, James A. Fitzpatrick, Grand Gulf Nuclear Station, Indian Point Units 2and 3, Palisades Plant, Pilgrim Nuclear Power Station, River Bend Station, Vermont Yankee, and Waterford 3.The inspectors reviewed root cause analyses documented in CR-HQN-2009-01 184 and CR-HQN-2010-00013, and the results of the licensee's extent of condition reviews and plant impact assessments.

The inspectors also independently assessed the potential impacts of the missed inspections on the operability of plant equipment by reviewing all of the examples identified by the licensee, and by independently reviewing completed modifications and work orders to identify additional examples.

The inspectors also reviewed the corrective action database to assess reported equipment failures in order to assess whether the failure might have involved missed QC verification inspections.

The inspectors assessed causalfactors that may have contributed to missing QC verification inspections.

This assessment included reviewing the Entergy Quality a.Enclosure b.37 Assurance Program Manual(OAPM)requirements, changes made to the QAPM, and the level of agreement between the QAPM and its implementing procedures.

Specific documents reviewed are listed in the attachment.

Findinqs and Observations The inspectors identified problems with the implementation of elements of the Quality Assurance (QA) Program that affected the fleet of Entergy Operations Inc., (hereafter referred to as "Entergy")

nuclear power plants that are licensed by the NRC. While the plant organizations are NRC licensees, Entergy also has corporate groups which are not NRC licensees that are actively involved in some activities affecting sites, including program and procedure changes. Entergy adopted a business strategy of adopting standard programs and procedures at allfleet plants.On October 30, 2009, the NRC discussed with Entergy personnel the initial concerns about whether QC verification inspections were being performed consistently for the types of work that require that level of inspection.

Both the non-licensed and licensed Entergy organizations responded with an appropriate review of the issues. Entergy's review of work documents that were potentially affected was extensive at each site.Entergy's total review examined over 320 Engineering Change documents and 2676 work orders. Of the 30 work orders identified to have QC verification inspection deficiencies affecting eight safety-related design changes, all 30 were determined by Entergy personnel to have sufficient documentation to provide confidence that the equipment was installed correctly.

Specific corrective actions were identified and implemented to ensure that QC verification inspections would be included in current and future work documents, including procedure enhancements.

The information provided to the NRC was used to perform a focused inspection in order to assess the impact of the missed verification inspections at each of the NRC-licensed facilities.

The inspection documented below independently assessed the potential impact of missed QC verification inspections on the operability of plant equipment, as well as assessing details of QA Program for the Entergy fleet.Two findings were identified during this inspection.

These findings involved missed QC verification inspections at seven Entergy sites, and the assignment of individuals to the QA Manager position that did not meet the experience and qualification requirements at eight sites. Only the findings impacting lndian Point are described below.The inspectors concluded that the Entergy fleet organizational structure and Entergy strategy of adopting standardized procedures across the fleet were contributing factors to the findings.

Specifically:

o Changes to adopt the standard fleet QA program created a partially conflict with existing requirements for worker qualifications at some sites. The process for creating and revising standardized fleet procedures and programs used to meet NRC requirements must ensure that site-specific regulatory requirements and commitments are properly addressed for all sites; and. Changes that removed details from existing site-specific QA and QC program implementing procedures while shifting to standardized fleet procedures contributed to the finding involving missed QC verification inspections.

Condition reports at Enclosure 38 individual sites regarding problems related to this issue were not recognized collectively as symptoms of a problem with these procedures because they were addressed at the site level.(1) Failure to Perform Required Qualitv Control Inspections lntroduction.

The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion X, "lnspection," because Entergy personnel did not ensure that quality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for construction-like work activities as required by the QAP.Description.

In response to the inspectors request for information concerning implementation of the quality oversight and verification programs, the licensee performed a review of a representative sample of engineering changes and work order tasks issued between 2006 and 2009. The licensee's review included performing equipment walkdowns, evaluating rework rates and human error rates, and causes for failures of significant components.

Based on the results of these reviews, Entergy initiated CRs at the various sites to document problems with Quality Control (QC)verification activities and failures to perform required QC reviews of safety-related engineering changes and construction related work activities.

Entergy's investigation concluded that procedures contained inadequate guidance, which resulted in inconsistent implementation of the QC Program. Specifically, some safety-related design change work orders were not reviewed to determine whether QC verification inspections were required, and some safety-related design change work orders did not include all required QC verification inspections.

These examples were documented in CR-HQN-2009-01083, -01084, -01085, -01093, -01096, -01140, -01169, -01170, -01184, and -01188.Additional findings identified by Entergy's review included: o Managers in maintenance organizations did not have a detailed understanding of QC responsibilities, required inspections, or what documents required review (CR HON-2009-01 150);. A weakness was identified in the process for ensuring proper approval of contract QC inspection personnel at all Entergy sites. Procedure EN-QV-1 11, "Training and Certification of Inspection/verification and examination Personnel," Section 4.0 [1], required that the Manager responsible for Quality Assurance or designee at each location is responsible for approving ANSI N45.2.6 certification of QC inspection personnel.

ln practice, contract QC inspectors'qualifications were not approved by the QA Manager prior to November of 2009. This was determined to be a minor violation because the ANSI Level lll inspector at each site was documenting that the contract QC personnel had the necessary qualifications to perform the inspections for which they were contracted.

This issue was entered into the Entergy's CAP as CR-HQN-2009-1091; r At individual Entergy plants, 27 CRs were written in 2008 and 2009 to document potentially missed QC verification inspections or missed reviews to consider QC verification inspections prior to the NRC engaging Entergy on this issue. Of those, seven were actual missed inspections (CR-RBS-2009-05041, CR-JAF-2008-03648, and CR-PNP-2008-0091 6 and CR-PNP-2 008-03922, CR-PNP-2009-01798, CR-PNP-2009-02059, and CR-PN P-2009-02255).

Multiple CRs documented work Enclosure 39 paekage quality issues that impacted the ability to identify appropriate QC verification inspection req uirements; r Two examples of QC programmatic issues were identified, assigned the Entergy headquarters, and not properly addressed (CR-ANO-C-2009-01884, and CR-HQN-2009-00178).

These were considered examples of the violation discussed below;r Although equipment-related QC CRs were addressed appropriately, QC programmatic issues were not always effectively addressed; and. QA audits and oversight activities for the QC Program missed opportunities to identify the findings of their investigation (CR-HQN-2009-01169, CR-HQN-2009-0153, and CR-HQN-2010-00013).

ln particular, the Entergy corporate ANSI Level lll inspector was required to perform periodic surveillances of QC inspection activities to ensure the program is being adequately implemented and maintained, but these required surveillances were not performed in 2008 (CR-HON-2009-001 1 1). This is further discussed in Section 4OA7.Subsequent to the identification of these deficiencies, Entergy personnel initiated corrective actions to ensure that appropriate safety-related, engineering changes and non-routine maintenance work orders were identified and routed to the Maintenance lnspection Coordinator for evaluation and inclusion of QC verification inspections in accordance with the revised requirements of procedure EN-WM-105, "Planning." These corrective actions and actions to preclude recurrence were collectively documented in the following Level A CRs: CR-HQN 2009-01 184, dated December 21, 2009 and CR-HQN-2010-0013, dated January 6, 2010.In-office NRC reviews identified the need to conduct further inspection activities, On June 14 through 17 , 2Q10, the inspectors conducted a focused review of work performed at each NRC-licensed Entergy site to assess whether examples of missed QC verification inspections identified by Entergy during their review had the potential to have impacted the operability of important plant equipment.

The inspectors also reviewed the corrective action database and maintenance records to independently assess the rigor of the Entergy review and to identify additional examples of missed QC verification inspections.

The inspectors identified no additional examples, and concluded that the Entergy reviews were sufficient to identify the scope of the problems and develop actions to address the causes.The inspectors' reviewed specific work items whose scope met QAPM requirements to have had QC verification inspections but did not have the appropriate inspections.

Based in part on interviews with Entergy personnel, the inspectors determined that procedural guidance for work planning was not sufficiently detailed or clear to ensure that work packages with construction-like activities would be reviewed by the specified QC personnel.

These individuals were responsible for designating the QC inspections that were required by the QAPM.The inspectors also identified numerous CRs written at Entergy sites that documented improper implementation of QC verification inspections.

Specific CRs are listed in the attachment.

Analvsis.

The performance deficiency associated with this finding was that Entergy personnel did not ensure that ouality control verification inspections were consistently included and correctly specified in quality-affecting procedures and work instructions for Enclosure 40 construction-like work activities as required by the QAP, This finding is more than minor because it's a programmatic deficiency that if left uncorrected, could lead to a more significant safety concern in that the failure to check quality attributes could involve an actual impact to plant equipment.

This finding affected the design control attribute of the Mitigating Systems cornerstone because missed quality control inspections during plant modifications could impact the availability, reliability, and capability of systems needed to respond to initiating events.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding is a qualification deficiency confirmed not to result in a loss of operability or functionality.

Specifically, inspectors verified by sampling that work documents provided objective quality evidence that work activities that had missed quality control verifications were properly performed.

The finding has a cross-cutting aspect in the area of human performance associated with the decision-making attribute because the licensee did not have an effective systematic process for obtaining interdisciplinary reviews of proposed work instructions to determine whether quality control verification inspections were appropriate.

H.1(a)per IMC 03101 (Section 4OA2.1.1)Enforcement.

10 CFR Part 50, Appendix B, Criterion X, "lnspection," requires, in part, that examinations, measurements, or tests of material...

shall be performed for each work operation where necessary to assure quality . . . lf mandatory inspection hold points, which require witnessing or inspecting by the licensee's designated representative and beyond which work shall not proceed without the consent of the designated representative are required, the specific hold points shall be indicated in appropriate documents.

Entergy's QAPM, Revision 20, Section B.12., "lnspection" requires, in part, that: "Provisions to ensure inspection planning is properly accomplished are to be established.

Planning activities are to identify the characteristics and activities to be inspected, the inspection techniques, the acceptance criteria, and the organization responsible for performing the inspection.

Provisions to identify inspection hold points, beyond which work is not to proceed without consent of the inspection organization, are to be defined." Contrary to the above, from February 2006 to December 2009, the licensee failed to ensure that examinations, measurements, or tests of material were performed for each work operation where necessary to assure quality, and failed to include mandatory inspection hold points in appropriate documents.

Specifically, multiple examples of Maintenance Work Orders and Engineering Change documents for construction-related activities involving safety-related systems structures and components were identified where witnessing or inspections were required to be performed to ensure quality, but these steps were not identified, included in the work documents, or performed as required QC hold points in the work instructions.

Condition reports documenting the specific problems and examples of the violation included: cR-lP2-2009-05321 cR-1P2-2009-05399 cR-HQN-2009-01085 cR-tP2-2009-05348 cR-tP3-2009-04883-cR-HQN-2009-01083 cR-tP2-2009-05400 cR-rP2-2009-05389 cR-HQN-2009-01084 41 CR-HQN-2009-01093 CR-HQN-2009-01096 CR-HQN-2009-01169 CR-HQN-2009-01170 cR-HQN-2009-01 188*determined to be related to Unit 2 CR-HQN-2009-01 140 cR-HQN-2009-01 184 Because this finding was of very low safety significance and was entered into Entergy's CAP as CR-HQN 2009-01 184 and CR-HQN-2O10-0013, consistent with Section 2.3.2 oI the Enforcement Policy, this violation is being treated as a NCV: NCV 0500024712010005-04, Failure to Perform Required Quality Control Inspections.

(2) Failure to lmplement the Experience and Qualification Requirements Associated With the Qualitv Assurange Prooram lntroduction.

The inspectors identified a Green NCV of 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," because Entergy personnel did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of quality assurance manager (OAM) met the qualification and experience requirements of ANSI/ANS 3.1-1978.

Specifically, the individual assigned as the responsible person for the Entergy's overall implementation of the QAP did not have at least 1 year of nuclear plant experience in the overall implementation of the QAP within the quality assurance organization prior to assuming those responsibilities.

Description.

During their review of the issues surrounding the improper implementation of quality control (QC) verifications discussed above, the inspectors noted that the root cause analysis documented in CR-HQN-2O10-0013 identified that lack of experience of the Quality Assurance (QA) Manager contributed to the failure to identify the trend in missed QC verification inspections.

The inspectors reviewed the relevant experience and qualifications of the QA Manager at each Entergy site. The inspectors also reviewed the NRC's safety evaluation report that approved Entergy's original corporate Quality Assurance Program Manual (QAPM), which is the document that contains the QA Program, Additionally, the inspectors reviewed the administrative section of the Technical Specifications for all the Entergy sites and a sample of evaluations, performed in accordance with 10 CFR 50.sa(a), that supported Entergy QAPM changes and alignment of plants that.were subsequently purchased by Entergy.The Entergy corporate QAPM required each site to meet the experience and qualification standards in ANSI/ANS 3.1-1978, "American National Standard for Selection and Training of Nuclear Power Plant Personnel." Section 4.4 included qualification and experience requirements for the personnel described as "group leaders" of five professional{echnical groups, including Quality Assurance.

Section 4.4.5, "Quality Assurance," required that ". ..the responsible person shall have six years experience in the field of quality assurance, preferably at an operating nuclear plant, or operations supervisory experience.

At least one year of this six years experience shall be nuclear power plant experience in the overall implementation of the quality assurance program. (This experience shall be obtained within the quality assurance organization.)" On December 15, 2008, procedure EN-QV-1 17, "Oversight Training Program," the Entergy procedure used by all Entergy sites to implement the requirements of ANSI/ANS 3.1-1978, was revised by the Entergy corporate QA group. Section 5.7, "Manager/QA Senior Auditor Training," was changed to state: Enclosure 42 Either the QA Manager or the Senior QA Auditor will meet the requirements of ANS 3.1-1978 paragraph 4.4.5'for operating plants and if applicable ANS 3.1-1993 paragraph 4.3.7 for new plants.The inspectors reviewed completed Personnel Change Planning ChecklisUForms for QA Managers at each site. Entergy used this form to evaluate QA manager candidates prior to the implementation of an Entergy fleet-wide restructuring in July 2007. Attachment 8,"Change Management Guidelines for Alignment lmplementation," included the following conclusion for the individual that subsequently was assigned to be the QA Manager: Individual's name redacted]

meets the minimum requirements for QA Manager with the exception of at least one year of this six years experience shall be nuclear power plant experience in the overall implementation of the quality assurance program. This requirement must be met by the QA Senior Auditor.Based on discussions with Entergy corporate QA personnel, the inspectors determined that Entergy personnel had interpreted ANSI/ANS 3. 1-1978, Sections 4.4 and 4.4.5 to allow the Senior Auditor to be considered the QA group leader described in the standard for purposes of meeting the experience reguirements of Section 4.4.5 in cases where a candidate for the position of QA Manager did not satisfy the experience requirements.

In reviewing this issue, the NRC staff has determined that the group leader in this case is the individual filling the position assigned responsibility for overall implementation of the QA Program (Entergy used the title "QA Manager" for this position).

The individual meeting the experience and qualification requirements must be the individual assigned the responsibilities for overall implementation of the QA Program assigned within the QA Program.The inspectors determined that this change to procedure EN-QV-117 did not ensure that the qualifications for the QA Manager would meet the requirements of standard.

The inspectors identified an example where the Senior Auditor was credited as being the group leader for purposes of meeting ANSI/ANS 3.1-1978, and the individual who was assigned as the QA Manager did not meet the ANSI/ANS 3.1-1978 experience requirements.

The team also determined that the responsibilities assigned to the QA Manager under the QAPM were not reassigned to the Senior Auditor, and the Senior Auditor did not report directly to the designated senior executive.

The Senior Auditor continued to report to the QA Manager, so the person with the greater experience did not have the positional authority to decide issues.Analvsis.

The performance deficiency associated with this finding was that Entergy did not implement the qualification and experience requirements of the QAP to ensure that an individual assigned to the position of QAM met the qualification and experience requirements of ANSI/ANS 3.1-1978.

This finding is more than minor because if left uncorrected, it could lead a more significant safety concern. Specifically, the failure to have a fully qualified individual providing overall oversight to the QAP had the potential to affect all cornerstones.

However, this finding will be tracked under the Mitigating Systems cornerstone as the area most likely to be impacted.The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.

Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the Enclosure 43 finding to be of very low safety significance (Green) because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist.The inspectors determined that there was no cross-cutting aspect associated with this finding because the performance deficiency did not reflect Entergy' current performance.

Specifically, the performance deficiency occurred more than three years ago and was outside the current assessment period.Enforcement.

10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," requires, in part, that the licensee establish a quality assurance program which complies with Appendix B. This program shall be documented by written policies, procedures, or instructions and shall be carried out throughout plant life in accordance with those policies, procedures, or instructions.

The program shall provide for indoctrination and training of personnel performing activities affecting quality as necessary to assure that suitable proficiency is achieved and maintained.

The Entergy Quality Assurance Program Manual, Revision 13, is the document used at each Entergy-owned site to describe the quality assurance program. Table 1, Section A of the Quality Assurance Program Manual states, in part, that qualifications and experience for station personnel shall meet ANSI/ANS 3.1-1978 except for positions where an exception to either ANSI/ANS 3.1-1978 or N18.1-1971 is stated in the applicable unit's Technical Specifications.

ANSI/ANS 3.1-1978, Section 4.4.5, "Quality Assurance," states, in part, that the responsible person (i.e. the Quality Assurance Manager) shall have six years experience in the field of quality assurance.

At least one year of this six years experience shall be obtained within the quality assurance organization.

Contrary to the above, between July 7,20Q7 and July 8, 2008, the licensee failed to implement the quality assurance program requirements intended to provide indoctrination and training of personnel performing activities affecting quality as necessary to assure that suitable proficiency was achieved and maintained.

Specifically, the individual assigned to be the responsible person for the licensee's overall implementation of the Quality Assurance Program did not have at least 1 year of nuclear plant experience in the overall implementation of the Quality Assurance Program within the quality assurance organization prior to assuming those responsibilities.

Because this finding was of very low safety significance and was entered into Entergy's CAP as CR-HQN-2010-00386, consistent with Section 2.3.2 of the Enforcement Policy, this violation is being treated as a NCV: NCV 0500024712010005-05, Failure to lmplement the Experience and Qualification Requirements of the Quality Assurance Program.Enclosure 40A3 44 Event Follow-Up (71153 - 3 samples)(Closed) Licensee Event Report 05000247/2010-007-00, Automatic Reactor Trip Due to a Turbine Trip as a Result of a Hiqh Steam Generator Level Trip After Transition to Sinqle Feedwater Pump Operation Inspection Scope On September 3, 2010, during a scheduled plant shutdown, an automatic reactor trip occurred at approxim ately 41%o power as a result of a turbine trip due to a high steam generator (SG) water level. The inspectors evaluated the response of control room personnel and plant equipment following the automatic reactor trip as described in NRC lnspection Report 0500024712010004.

Entergy personnel determined that the root cause of the eventwas inadequate design controlof the proportional band and reset tuning settings for critical plant controllers; and that there was less than optimum settings on the MBFP speed controller, feed regulatory valve flow controllers, and the SG level controllers for low power operations.

The immediate corrective actions included changing the MBFP speed controller settings to the optimum settings.

Entergy personnel documented the root cause evaluation in CR 1P2-2010-05484.

This LER is closed.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one event follow-up sample as defined in NRC Inspection Procedure 7 1 153.Findinqs lntroduction.

A Green self-revealing finding was identified because Entergy's procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control," did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations, contributing to a reactor trip from 41o/o power during a planned shutdown on September 3, 2010.Description.

On September 3, 201A, during a planned shutdown to repair the 21 reactor coolant pump, an automatic reactor trip occurred as a result of a turbine trip due to a high steam generator (SG) water level. Prior to the event, operations personnel had reduced reactor power from 100% to 41o/o with both MBFPs in operation.

Operators removed the 21 MBFP from service as planned, and the 22 MBFP increased in speed to make up for the 21 MBFP being removed from service. However,22 MBFP was slow to increase in speed, resulting in a decrease in water levelto allfour SGs. The 22MBPF continued to increase in speed and flow even when SG level began to recover, causing an increase in SG water level. Due to the increasing SG water level, operators took manual control of the 24feed regulation valve (FRV) to reduce feedwater flow. The 22 and 23 FRVs automatically responded by reducing flow to the 22 and 23 SGs.Operations personnel also took manual control of the 21 FRV to reduce flow to hhe 21 SG. The decrease in flow to the 21 and 24 SGs resulted in an increase in feedwater flow to the 22 and 23 SGs, until the high level trip setpoint was reached in the 23 SG, and a turbine trip and reactor trip was automatically initiated per the plant design.Entergy personnel performed a root cause evaluation (CR-lP2-2010-5484), and determined the root cause was inadequate design control of the proportional band and ,1 Enclosure 45 reset tuning settings for critical plant controllers.

Entergy personnel determine there were less than optimum controller settings on the MBFP speed controller, feed regulatory valve flow controllers, and steam generator level controllers for low power operations.

Entergy personneltook immediate corrective actions to change the MBFP speed controller settings.

Entergy's corrective actions included reviewing l&C procedures to ensure that the instrument calibration requirements matched l&C preventative maintenance documents, and a list of critical controllers was generated and the Equipment Data Base (EDB) updated with known controller settings.

Entergy's planned corrective actions include reviewing l&C procedures to identify changes to ensure controller calibrations maintain required settings, reviewing procedures to incorporate testing of critical parameters, and issuing an engineering evaluation and updating the EDB in the work control program with findings on controller settings.The inspectors reviewed a design change on May 5,2Q06, where Entergy staff processed a change to remove the settings for the MBFP speed controllers from l&C Procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control." As a result, the MBFP speed controller settings were not maintained at the proper settings.

The inspectors determined the change was processed through DRN-06-02146 inappropriately as an editorial change and not a technical change and thus did not receive a cross-disciplinary review and user validation required by procedure lP-SMM-AD-102, "IPEC lmplementing Procedure Preparation, Review, and Approval." The speed controller settings caused a slower response of the 22MBFP after the 21 MBFP was removed from service. The inspectors determined that without prescribed MBFP speed controller settings, that l&C procedure 2-lC-PC-N-P-408A, "Main Boiler Feed Pump Discharge Pressure Speed Control," was not adequate to ensure proper operation of the MBFPS.Analvsis.

The performance deficiency associated with this finding was that Entergy's procedure 2-lC-PC-N-P-408A did not provide adequate guidance to ensure proper settings for the MBFP speed controller settings at low power operations.

This finding is more than minor because it is associated with the design control attribute of the Initiating Events cornerstone and affects the cornerstone objective of limiting the likelihood of those events that upset plant stability and challenge critical safety functions during power operations.

Specifically, inadequate design control of the MBFP speed controller settings contributed to a reactor trip.Using IMC 0609.04, "Phase 1 - Initial Screening and Characterization of Findings," the finding was determined to have very low safety significance (Green) because the finding did not contribute to the likelihood that mitigation equipment or functions would not be available, The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect current licensee performance.

Specifically, the performance deficiency occurred several years ago and was outside the current assessment period.Enforcement.

This finding does not involve enforcement action because no regulatory requirement violation was identified.

Because this finding does not involve a violation, has very low safety significance, and it was entered into Entergy's CAP as CR 1P2-2010'05484, it is identified as a finding: FIN 500024712010005-06, Inadequate Main Boiler Feed Pump Speed Gontroller Setting.Enclosure 46.2 Automatic Reactor Trip on Turbine Trip Due to 21 Main Transformer Failure lnspection Scope The inspectors reviewed the below listed event for plant status and mitigating actions to evaluate Entergy performance and confirm that Entergy operators implemented actions and notifications (if required)in accordance with station procedures.

The inspectors also reviewed Entergy's emergency response actions to evaluate Entergy staff performance and confirm that Entergy staff implemented actions and notifications in accordance with station procedures for the Alert declaration.

At 1839 hours0.0213 days <br />0.511 hours <br />0.00304 weeks <br />6.997395e-4 months <br /> on November 7, 2010, Unit 2 experienced a reactor trip. At 1841 , the Unit 2 control room operators were informed that that there had been an explosion in the Unit 2 transformer yard/diesel generator building area. The station fire brigade was activated to respond to the notification of explosion.

Soon thereafter, a second explosion occurred, and this one was felt and heard in the Unit 2 control room. At 1849, the Unit 2 Shift Manager declared an Alert emergency based on reports of two explosions in the transformer yard (Entergy subsequently determined that both explosions were the result of the 21 main transformer failure).

The Alert declaration was made in accordance with emergency action level (EAL) 8.2.3, which states "fire or explosion in any plant area, Table 8.1, which causes or potentially causes any required safety related system or structure to become inoperable." The diesel generator building/fuel tank area is listed in Table 8.1. The operation's crew activated the IPEC emergency response organization (ERO) to respond to the event. Entergy staff terminated the emergency at 2218 hours0.0257 days <br />0.616 hours <br />0.00367 weeks <br />8.43949e-4 months <br />.The inspectors evaluated the response of control room personnel following the automatic reactor trip that occurred as a result of the failure of 21 main transformer.

The inspectors reviewed plant computer data, including the sequence of events report, evaluated plant parameter traces, and discussed the event with plant personnel, to verify that plant equipment responded as expected, and to ensure that operating procedures were appropriately implemented.

The inspectors also verified that Entergy's post trip review group (PTRG) identified the most probable cause(s) of the trip to facilitate corrective actions prior to restart. This event and the PTRG report were entered into Entergy's CAP as CR-lP2-201 0-0680't.The inspectors also reviewed Entergy actions and decision making to verify decisions were consistent with a conservative approach to assessing the condition and in accordance with the site emergency plan. The inspectors reviewed logs and records from the night of the event, interviewed operational and emergency planning staff, and reviewed Alert Report and other corrective action documentation.

Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one event follow-up sample as defined in Inspection Procedure 71153.Findinqs No findings were identified associated with the operational response to the reactor trip.b.Enclosure 47 There were two findings identified regarding Entergy staff's implementation of the emergency plan. The inspectors will conduct further review of the root cause evaluation (RCE) and associated corrective actions in conjunction with review of the licensee event report to be submitted by Entergy personnel.

(1) Failure to Staff the TSC and OSC within the Required Time Limit

Introduction.

A Green self-revealing NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q) was identified because Entergy staff did not adequately implement the requirements of the IPEC Emergency Plan.Description.

On the evening of November 7,2010, the Unit 2 operating crew declared an Alert emergency at 1849 hours0.0214 days <br />0.514 hours <br />0.00306 weeks <br />7.035445e-4 months <br />. At 1852 hours0.0214 days <br />0.514 hours <br />0.00306 weeks <br />7.04686e-4 months <br />, the crew activated the Dialogic System, which notifies the site ERO of the event and requires the augmentation of the on-shift ERO by the on-call responders.

The IPEC Emergency Plan, Section H, Emergency Facilities and Equipment, requires that the TSC and OSC be operational within 60 minutes after a declaration of an Alert, Site Area Emergency, or General Emergency.

The TSC was staffed and declared operational at 2008 hours0.0232 days <br />0.558 hours <br />0.00332 weeks <br />7.64044e-4 months <br />, and the OSC was staffed and declared operational at 2015 hours0.0233 days <br />0.56 hours <br />0.00333 weeks <br />7.667075e-4 months <br />. Both of these activation times exceeded the 60 minute staffing requirement in the IPEC Emergency Plan.Entergy determined that two factors contributed to the failure to staff the emergency response facilities in the required time. First, there were notified ERO members who questioned the validity of the beeper indications or believed that other ERO members would respond, and therefore did not respond to their assigned emergency response facility.

Entergy determined this behavior was not in accordance with the IPEC ERO augmentation design and training nor consistent with station expectations.

Second, during the event, problems occurred with the beeper and phone systems used for ERO call-in. Some of the ERO responders indicated that the system recording stated there was no emergency, while other personnel received a beep but were unable to call in.The failure to comply with the requirements of the IPEC Emergency Plan resulted in Entergy's failure to comply with NRC regulations for timely augmentation of emergency response capabilities.

Entergy personnel documented the station's performance during the Alert emergency in an event report, and initiated several condition reports to address deficiencies in equipment and personnel performance.

CR-lP2-2010-06870 was written to investigate and correct the condition that the TSC and OSC did not meet minimum required staffing within the required 60 minutes. CR-lP2-2010-6813 and CR-IP2-2010-6831 were initiated to address the reported technical problems with the beeper and phone system, while CR-lP2-2010-6871 was written to address why certain individuals on the on-call ERO team did not report to the site or were late.The inspectors reviewed the event report and the CRs to assess the adequacy of Entergy's self-assessment and of the planned corrective actions. The inspectors determined that Entergy had identified the causes of the November 7 staffing issues and concluded that actions taken and planned corrective actions were adequate.Analvsis.

The performance deficiency associated with this finding was that Entergy personnel did not meet the requirements of the IPEC Emergency Plan in that the TSC and OSC were not staffed nor declared operational within 60 minutes of the Alert Enclosure 48 emergency declaration on November 7,2010. This finding is more than minor because it affected the Emergency Response Organization attribute of the EP Cornerstone to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.2 and Sheet 2, "Actual Event lmplementation Problem," and determined that the failure to comply with an aspect of the Emergency Plan related to ERO augmentation (10 CFR 50.47(b)(2))

was a non-risk-significant planning standard problem which occurred during an Alert emergency and is therefore a Green finding.This finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute of defining and effectively communicating expectations regarding procedural compliance and personnel following procedures.

Specifically, Entergy staff did not comply with ERO expectations and procedures regarding prompt reporting to an assigned emergency response facility during an actual event. [H.a(b) per rMc 03101

Enforcement.

10 CFR 50.54(q) requires, in part, that a licensee "shallfollow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX2)requires, in part, that"timely augmentation of response capabilities is available." Contrary to the above, on November 7, 2010, the IPEC ERO did not respond and staff the site TSC and OSC in a timely manner. The IPEC Emergency Plan requires that these facilities be staffed and operational within 60 minutes of an Alert emergency declaration.

On November 7, the TSC was declared operational 79 minutes after the Alert declaration, and the OSC 86 minutes after the declaration.

By failing to meet the requirements of the IPEC Emergency Plan, and therefore 10 CFR 50.47(b)(2), Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan. Entergy initiated training and counseling corrective actions to address the personnel performance issues and equipment issues. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR- lP2-2010-6813, -6831, and -6870, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 00500024712010005-07, Failure to Staff the Site TSC and OSC within 60 Minutes of an Alert Emergency Declaration.

(2) Failure of Offsite Notification Procedure to Meet the Requirements of the Site Emerqencv Plan

Introduction.

The inspectors identified a Green NCV of 10 CFR 50.54, "Conditions of Licenses," paragraph (q) because the Entergy EPIP for notification of offsite officials did not meet the requirements of the IPEC Emergency Plan.Description.

Following the declaration of the Alert emergency at 1849 hours0.0214 days <br />0.514 hours <br />0.00306 weeks <br />7.035445e-4 months <br /> on November 7, 2010, the central control room (CCR) crew entered EPIP IP-EP-210,"Central Control Room." Attachment 9.1, Shift Manager/POM (Emergency Director)Checklist, of the EPIP directs the Shift Manager to complete a NYS Radiological Emergency Data Form, Part 1 (Form EP-1), and then have the CCR Offsite Enclosure 49 Communicator email and fax the form to offsite authorities.

Using the radiological emergency communication system (RECS) and Form EP-4, the Offsite Communicator confirms receipt of the Part 1 Form by offsite authorities.

A note in Attachment 9.1 requires that notification of state and local authorities shall be initiated within 15 minutes of an Alert declaration.

The IPEC Emergency Plan, Section E, Notification Methods and Procedures, paragraph 1.b.5, requires in part that an immediate notification (within 15 minutes) of an Alert is made by the Shift Manager or his designee to the New York State and Westchester, Rockland, Putnam, and Orange Counties.

NRC regulations, specifically 10 CFR 50.47(bX5), require in part that "procedures have been established for notification, by the licensee, of State and local response organizations." On the evening of November 7, when the Offsite Communicator attempted, via a telephone conference line, to confirm receipt of the Part 1 Form, the communicator learned that a problem had occurred with the fax machine and the only offsite authority to have received the fax was New York State. Per the direction of the guidance in Form EP-4, the Offsite Communicator instructed the four county personnel on the telephone conference to obtain the Form 1 from the State. One of the county personnel requested the Offsite Communicator to read the Form 1 over the conference line. The Offsite Communicator complied with the request and read the Form 1 information to the four county personnel at approximately 1902 hours0.022 days <br />0.528 hours <br />0.00314 weeks <br />7.23711e-4 months <br />, within 15 minutes of 1849 hours0.0214 days <br />0.514 hours <br />0.00306 weeks <br />7.035445e-4 months <br />.On November 8, 2010, in response to Entergy's event notification to the NRC, the Region I senior emergency preparedness inspector discussed the November 7 event with the IPEC Emergency Planning Manager. The inspector questioned that Form EP-4 provided for the delegation of Entergy's responsibility for notification, an apparent contradiction of Emergency Plan requirements.

Due to County staff intervention, the offsite notifications were adequately performed, but the NRC inspector identified that had the Offsite Communicator followed his procedural guidance, the notifications would not have been made in accordance with IPEC Emergency Plan requirements or with NRC regulations.

The inspector determined that Form EP-4 had provided for the deficient backup method since it was revised in July 2006. Entergy initiated in CR-lP2-2010-07563 to investigate and resolve Form EP-4 deficiency concerning the backup method for offsite notification.

Entergy personnel determined the problem encountered with the fax machine on the evening of November 7,2010, was due to a design flaw in the MIDAS software package used to construct the Form 1. The flaw involved a feature that would prevent sending the Form 1 file if the user attempts to send the file before a data compiling feature of the program has completed its function.

Entergy personnel concluded that on November 7, the Offsite Communicator had attempted to send the form too soon after data had been entered. The problems encountered with MIDAS were replicated after the event, and Entergy initiated software design changes to the MIDAS program to correct the timing deficiency.

The NRC reviewed the IPEC Emergency Plan and its associated EPlPs, reviewed records from the November 7,2010, event, and discussed the issue with IPEC and County personnel.

Further, the inspector reviewed the planned changes to Form EP-4 and the intended design changes to the MIDAS and fax software.

The inspector concluded the planned corrective actions appeared adequate to correct the problems identified as a result of the November 7,2010 event.Enclosure

.3 50 Analvsis.

The performance deficiency associated with this finding was that Entergy procedures allowed for a back-up notification process that did not comply with the requirements of the site emergency plan: the emergency plan requires that the Shift Manager or his designee notify the offsite authorities of an emergency declaration, while Form EP-4 directed the delegation of this responsibility to an offsite authority itself. This finding is more than minor because it affected the Emergency Response Organization attribute of the EP cornerstone to ensure that the licensee is capable of implementing adequate measures to protect the public health and safety in the event of a radiological emergency.

In accordance with IMC 0609, Appendix B, "Emergency Preparedness Significance Determination Process," the inspectors determined the finding to be of very low safety significance (Green). Specifically, the inspectors utilized IMC 0609, Appendix B, Section 4.5 and Sheet 1, "Failure to Comply," and determined that the failure to comply with an aspect of the Emergency Plan related to event notification (10 CFR 50.47(bX5))

was a risk-significant planning standard (RSPS) problem. lt was not a RSPS functionalfailure of the IPEC event notification process, because the deficiency in the IPEC EPIP was in the backup method for offsite notification, and despite the procedural flaw offsite notifications were made in a timely and accurate manner on November 7,2Q10.The inspectors determined there was no cross-cutting issue associated with the finding because the performance deficiency did not reflect current licensee performance.

Specifically, the performance deficiency occurred greater than three years ago and was outside the current assessment period.Enforcement.

10 CFR 50.54, "Conditions of Licenses," paragraph (q) requires, in part, that a licensee "shall follow and maintain in effect emergency plans which meet the standards in 10 CFR 50.47(b) and the requirements in Appendix E of this part." 10 CFR 50.47(bX5)requires, in part, that "procedures have been established for notification, by the licensee, of State and local response organizations." Contrary to the above, since July 2006 Entergy IPEC EPIPs provided a backup notification method that delegated the licensee's responsibility for offsite notifications to an offsite authority.

The IPEC Emergency Plan and 10 CFR 50.47(bX5)require that the Entergy IPEC staff perform the notification of offsite authorities.

Due to this procedure deficiency, Entergy was in violation of 10 CFR 50.54(q) for not properly maintaining the conditions of the IPEC Emergency Plan. Entergy initiated corrective actions to correct Form EP-4 by having the Offsite Communicator read the Part 1 Form to the offsite authorities if the faxlemail method does not work. Because this finding is of very low safety significance and was entered into Entergy's CAP as CR-lP2-2010-07563, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as a NCV: NCV 005000247 and 005000286/2010005-08, Failure of Offsite Notification Procedure to Meet the Requirements of the Site Emergency Plan.Loaded Multi-Purpose Canister Stuck Durinq Transfer from the HI-TRAC Transfer Cask to a HI-STORM Storaqe Cask Inspection Scope The inspectors reviewed the below listed equipment problem for plant status and mitigating actions to evaluate Entergy personnel performance and confirm that the a.Enclosure b.51 Entergy staff implemented actions and notifications in accordance with station procedures.

From July through November 2010, Entergy personnel conducted a campaign to place selected spent fuel elements into dry cask storage. On November 18, 2010, during the stack up and transfer of a fully loaded Multipurpose Canister (MPC) MPC-32 canister from the HI-TRAC transfer cask into a HI-STORM storage cask, the MPC became lodged while partially inserted into the mating device. The MPC had been lowered approximately 8 inches into the mating device from the HI-TRAC, but became lodged and could not be lowered or raised with the fuel storage building (FSB) gantry crane.Through consultation with representatives of Holtec International (Holtec), the storage system vendor; and Ederer, the Unit 2 FSB gantry crane manufacturer; Entergy personnel determined the problem to be a result of a misalignment of the HI-TRAC and the mating device that joins the HI-TRAC to the HI-STORM for the MPC transfer.

After not being able to dislodge the MPC during the stack up and transfer on November '18, 2010, Entergy personnel, in consultation with Ederer personnel on site, bypassed the crane load cell so that the 90,000 pound limit could be exceeded.

The FSB gantry crane auxiliary hoist was slowly and incrementally raised. At approximately 100,000 pounds the MPC was successfully dislodged, the load cell dropped down to approximately 87,000 pounds, and the MPC was able to be raised back into the HI-TRAC. The HI-TRAC and MPC were then lifted off the HI-STORM and mating device and placed into a safe storage position on November 19, 2010. Entergy personnel subsequently resumed dry cask operation stack up and transfer on December 13, 2010 and the MPC was able to be loaded into the HI-STORM that day. The HI-STORM was subsequently placed on the independent spent fuel storage installation (lSFSl) pad on December 16, 2010, and no additional problems were encountered.

The inspectors reviewed Entergy actions and decision making to verify decisions were consistent with a conservative approach to assessing and addressing the condition.

The inspectors reviewed whether Entergy evaluations (and/or vendor supplied correspondence)were supported and addressed the structural performance of the MPC.The inspectors also reviewed station evaluations that concluded there was no structural damage to the mating device. The inspectors determined that Entergy and vendor-supplied evaluations appropriately concluded that the MPC was not adversely impacted in either thermal or structural performance.

Entergy entered the issue into the CAP and plans to revise Holtec procedure 2-DCS-009-GEN, "MPC Transfer & HI-STORM Movement," to ensure that the HI-TRAC is properly aligned with the mating device before the next cask is loaded.Specific documents reviewed during this inspection are listed in the attachment.

These activities constitute completion of one event follow-up sample as defined in NRC Inspection Procedure 7 1 1 53.Findinqs No findings were identified.

52

4OA5 Other Activities

.1 Confirmatorv

Order. EA-09-060.

November 10. 2009. Failure to Provide Complete and Accurate lnformation Inspection Scope On May 22, 2008, the NRC completed a security baseline inspection at the Palisades Nuclear Plant. The inspection covered one or more of the key attributes of the security cornerstone of the NRC's Reactor Oversight Process. As a result of the inspection observations, the NRC Office of Investigations (Ol) initiated an investigation (Ol Case No. 3-2008-020).

Based on the evidence developed during the inspection and investigation, the NRC identified a violation of 10 CFR 50.9 for inaccurate and incomplete information.

Specifically, the licensee failed to ensure that information in corrective action documents was complete and accurate in all material respects and failed to provide accurate information to the Commission during a telephone conversation between a licensee employee and an NRC inspector.

The results of the investigation were sent to Entergy in a letter dated July 14,2009. This letter offered Entergy the opportunity to either participate in Alternate Dispute Resolution (ADR) mediation or to attend a Predecisional Enforcement Conference.

On July 28, 2009, the NRC and Entergy agreed to participate in ADR mediation.

On September 15, 2009, the NRC and Entergy participated in an ADR session and, as a result, a Confirmatory Order was issued pursuant to the agreement reached during the ADR process. As part of the ADR settlement agreement, Entergy agreed to a number of organizational, procedural, and management oversight related corrective actions and enhancements at Palisades Nuclear Plant and other Entergy Fleet nuclear sites.During this inspection at Indian Point Energy Center, from November 15 - 19, 2010, the inspectors evaluated the overall effectiveness of the licensee's response to Action ltem 2 of the Confirmatory Order. Specifically, Entergy developed and implemented a formal process, within the current CAP, that ensured that Safeguards and Security-Related information, which would othenrvise not be contained in the CAP, is processed in an auditable manner, consistent with Entergy's existing CAP.The evaluation was conducted through: 1) interviews with non-supervisory personnel at Indian Point Energy Center; 2) interviews with program managers and supervisors responsible for implementing the CAP at the site; and 3) an evaluation of licensee documents and procedures related to compliance with Action ltem 2 of the Confirmatory Order.The inspectors conducted the following specific inspection activities to:. Verify CRs that require documentation of Safeguards Information (SGl) were clearly identified as Safeguards CRs;o Verify where SGI is required to describe the condition or corrective actions, the additional information is contained in a uniquely identified and referenced safeguards document: Enclosure b.a..2 53 r Verify that CRs that require documentation of SGI reference the uniquely identified safeguards document and the uniquely identified safeguards document references the CR;. Verify the site security manager identified situations where SGI may need to be discussed for the Condition Review Group (CRG) and Corrective Action Review Board (CARB)to properly prioritize CRs or review CR evaluations, and that members of the CRG and CARB were qualified to review SGI;. Verify that review of the adequacy of the response to a corrective action was performed by safeguards qualified personnelwhen SGI was required to describe information in the Corrective Action (CA); and. Verify that closure reviews for safeguards CRs were performed by safeguards qualified personnel.

Findinqs No findings were identified.

Independent Spent Fuel Storaqe Installation Monitorinq Controls (60855)Inspection Scope The inspector reviewed routine operations and monitoring of the lSFSl. The inspector walked down the lSFSl, observed the condition of the storage modules including the air cooling ventilation openings, performed independent dose rate measurements of the storage modules, and reviewed logs that confirmed daily walkdowns were performed to observe ventilation openings for the months of August through November 2010 as specified in NRC Certificate of Compliance no. 1014 requirements.

Findinqs No findings were identified.

Review of the Shift Staffino Requirements Inspection Scope lnspectors reviewed the circumstances surrounding the February 9, 2010 occurrence where the Control Room Supervisor (CRS), assigned as having the control roorn command function, left the control room without designating another senior reactor operator qualified individual to assume the control room command function.Findinqs Command Function SLO Leaves the Control Room lntroduction.

A Green self-revealing NCV of TS 5.1, "Responsibility," was identified because on February 9,2010, the CRS assigned as having the control room command function, left the control room without designating another SRO-qualified individual to assume the control room command function.b..3 Enclosure 54

Description.

On February 9,2010, the CRS, one of two SRO-qualified individuals in the watch section, left the control room to lead the morning meeting. The Shift Supervisor (SS) was already out of the control room and the CRS had the responsibility for the control room command function at that time. This left the reactor operators with no senior reactor operator in the control room to respond to events.The Reactor Operator (RO) promptly recognized that there was no SRO in the control room and initiated actions to have the CRS return to the control. Upon hearing the RO paging him, the CRS realized his mistake and returned to the control room. The CRS was out of the control room for approximately 5 minutes. Technical Specification 5.1,"Responsibility," states that the SS shall be responsible for the control room command function and that during any absence of the SS from the control room while the unit is in MODE 1, 2,3, ot 4, an individual with an active Senior Reactor Operator (SRO) license shall be designated to assume the control room command function.

Entergy entered this issue into the CAP as CR-lP2-2010-00708.

Analvsis.

The performance deficiency associated with this finding was that the CRS left the control room without designating an SRO-qualified individual to assume the control room command function, contrary to the requirements of TS 5.1. His actions were also contrary to requirements of Entergy Nuclear Management Manual Procedure EN-OP-1 15, "Conduct of Operations." This finding is more than minor because it could reasonably be viewed as a precursor to a significant event. Specifically, the absence of SRO oversight during licensed control room activities increases the likelihood of human performance errors contributing to an initiating event and reduces the effectiveness of event mitigation.

The finding is associated with the human performance attribute of the Mitigating Systems cornerstone and affects the cornerstone objective of ensuring the availability, reliability and capability of systems that respond to initiating events to prevent undesirable consequences.

The finding was not suitable for quantitative assessment using existing Significance Determination Process guidance.

Using IMC 0609, Appendix M, "Significance Determination Process Using Qualitative Criteria," NRC management determined the finding to be of very low safety significance (Green) because of the short period the CRS was absent from the control room, and because no initiating events occurred during that time.The finding has a cross-cutting aspect in the area of human performance associated with the work practices attribute because of the ineffective use of shift turnover practices, in that the CRS did not self check or communicate his decision to leave the control room to the rest of the control room staff. [H.a(a) per IMC 0310]Enforcement.

Technical Specification 5.1, "Responsibility," states that the SS shall be responsible for the control room command function and that during any absence of the SS from the control room while the unit is in MODE 1, 2,3, or 4, an individual with an active Senior Reactor Operator (SRO) license shall be designated to assume the control room command function.Contrary to the above, on February 9,2010, while the unit was in MODE 1, the Unit 2 CRS left the control room for a period of approximately five minutes without designating an individualwith an active SRO license to assume the control room command function.Because this TS noncompliance is of very low safety significance (Green) and was Enclosure 55 entered into the CAP as CR-lP2-2010-00708, consistent with Section 2.3.2 of the NRC Enforcement Policy, this violation is being treated as an NCV: NCV 0500024712010005-09, Failure to Meet TS Oversight Requirement.

4OAO Meetinqs.

Includinq Exit On December 2,2Q10, the inspector presented inspection results of the radiation safety baseline inspection to Mr. Donald Mayer and other members of Entergy staff. The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.

No proprietary information was identified.

On December 9, 2010, the inspector presented the inspection results of the licensed operator requalification to members of licensee management.

The licensee acknowledged the issues presented.

The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.

No proprietary information was identified.

On January 10,2011, the inspector presented the results of the Selected lssue Follow-up Inspection of quality assurance and quality control issues to Mr. F. lnzirillo, Manager, Quality Assurance, and other members of the licensee staff. The licensee acknowledged the issues presented.

The inspector asked the licensee whether any materials examined during the inspection should be considered proprietary.

No proprietary information was identified.

On January 19,2Q11, the inspectors presented the inspection results of the integrated inspection to Mr. Joseph Pollock, Site Vice President, and other members of the Entergy staff. The licensee acknowledged the findings and observations presented.

The inspectors asked whether any materials examined during the inspection should be considered proprietary.

No proprietary information was identified.

4C.A7 Licensee-ldentified Violations The following violations of very low safety significance (Green) were identified by Entergy and are violations of NRC requirements which meet the criteria of the NRC Enforcement Policy, for being dispositioned as NCVs.o 1O CFR 50.47(bX4), requires that a standard emergency classification and action level scheme, the bases of which include facility system and effluent parameters, is in use by the licensee.

10 CFR 50.54(q), states in part, that licensees shall follow and maintain in effect emergency plans which meet the standards in 50.47(b).

Contrary to the above, on October 2Q,2010, during an extent of condition review of industry operating experience, Entergy personnel identified that the R-54 radiation monitor's (monitor is for liquid effluent from the waste distillate storage tanks) highest range of 4.7e-2 uCi/cc was below the value of 2.5e-1uCi/cc required to declare an Alert using emergency action level (EAL)Table 5.1.Entergy personnel documented this issue in the CAP as CR-IP2-20'10-06417 and provided timely guidance to the control room operators to ensure proper classification of an event. In addition, Entergy personnel performed an apparent cause evaluation which included an extent of condition of the issue. The EAL Enclosure 56 chart and associated emergency plan procedures were revised to reflect the EAL changes. The inspectors determined that this finding is of very low safety significance because it did not result in a significant degradation of the risk significant planning standard function.o 10 CFR 50, Appendix B, Criterion ll, "Quality Assurance Program," requires, in part, that the licensee establish a quality assurance program which complies with Appendix B. This program shall be documented by written policies, procedures, or instructions and shall be carried out throughout plant life in accordance with those policies, procedures, or instructions.

Procedure EN-QV-111, 'Training and Certification of InspectionA/erification and Examination Personnel," Section 4.0[4](i), requires that the Entergy corporate ANSI Level lll inspector shall perform periodic (annual) surveillances of quality control inspection activities to ensure that the program is being adequately implemented and maintained.

Contrary to the above, no surveillances of quality control inspection activities were performed for any Entergy site during calendar year 20Q8.The issue was not suitable for quantitative significance determination, so it was assessed using IMC 0609, Appendix M, and evaluated using the qualitative criteria listed in Table 4.1. This finding was determined to be of very low safety significance because other quality assurance program functions remained unaffected by this performance deficiency, so defense-in-depth continued to exist. This issue was entered into the Entergy's CAP as CR-HQN-2009-00111.

ATTACHMENT:

=SUPPLEMENTAL

INFORMATION=

KEY POINTS OF CONTACT

Site Vice President Echelon Chief Engineer NDE Level lll, Code Programs Specialist - Nuclear Safety/License

lV Supervisor - Engineering

Shift Manager Echelon Manager - Fleet Operations

Specialist - Nuclear Safety/License

lV Manager - System Engineering

Manager - Dry Cask Project Project Manager - NUC Specialist - Nuclear Safety/License

lV Engineer lll- Nuclear Assistant

Plant Manager Shift Manager Echelon General Manager - Plant Operations, Fleet Operations

Support Shift Manager Manager - Operations

Echelon Senior Manager - Nuclear Safety and Licensing Maintenance

Inspection

Coordinator

Manager - Security Echelon Manager - Quality Assurance Supervisor - Radiation

Protection

Manager - IPEC Quality Assurance Echelon Senior Vice President - Planning, Development

and Oversight Lead Engineer - Buried Pipe and Tank Program Superintendent - l&C Senior Lead Engineer Specialist - Senior HP/Chemical

Manager - Design Engineering

White Plains Vice President - Nuclear Safety, Emergency

Preparedness, and Licensing Echelon Senior Staff Engineer Director * Engineering

Echelon Vice President - Oversight Shift Manager Specialist - Nuclear Safety/License

lV Specialist - Corrective

Action Superintendent - Simulator Superintendent - Dry Fuel Storage Specialist - Senior HP/Chemical

Senior Reactor Operator Superintendent - Licensed Operator Requal Training Technical

Specialist

lV Echelon Director - Oversight Attachment

M. Tesoriero A. Vitale R. Walpole E. Weinkam A. Williams Open and Closed 0500024712010-005-01

0500024712010-005-02

FIN 05000247t2010-005-03

FrN 0500024712010-005-04

05000247 /2010-005-05

NCV NCV 0500024712010-005-06

0500024712010-005-07

NCV 0500024712010-005-08

Ncv 0500024712010-005-09

Closed 0500024712010-007-00

NCV A-2 Manager * Programs and Components

General Manager - Plant Operations

Manager - Licensing White Plains Senior Manager - Nuclear Safety and Licensing Manager - PS&O

LIST OF ITEMS OPENED, CLOSED, AND DISCUSSED

NCV FIN Inadequate

Compensatory

Measures for Outof-Service Plant Vent Process Radiation

Monitor (Section 1R19)Inadequate

Work Planning Control Relative to Regenerative

Heat Exchanger

Permanent Shielding

Modification

That Resulted in Additional

Unplanned

Collective

Exposure (Section 2RS2)Inadequate

Work Coordination

Relative to Reactor Cavity Liner Repair That Resulted in Additional

Unplanned

Collective

Exposure (Section 2RS2)Failure to Perform Required Quality Control lnspections (Section 4C.A2)Failure to lmplement

the Experience

and Qualification

Requirements

of the Quality Assurance

Program (Section 4OA2)Inadequate

Main Boiler Feed Pump Speed Controller

Setting (Section 4OA3)Failure to Staff the Site TSC and OSC Within 60 Minutes of an Alert Emergency

Declaration (Section 4OA3)Failure of Offsite Notification

Procedure

to Meet the Requirements

of the Site Emergency

Plan Section 4OA3)Failure to Meet TS Oversight

Requirement (Section 4OA5)LER Automatic Reactor Trip Due to a Turbine Trip as a Result of a High Steam Generator

Level Trip After Transition

to Single Feedwater

Pump Operation (Section 4OA3)Attachment

Refueling

Cavity Leakage into Containment (Section 4OA2)05000247t2010-002-02

uRl

LIST OF DOCUMENTS

REVIEWED Common Documents Used Indian Point Unit 2 Updated Final Safety Analysis Report Indian Point Unit 2 Individual Plant Examination Indian Point Unit 2 Individual Plant Examination of External Events Indian Point Unit 2Technical Specifications and Bases Indian Point Unit 2 Technical Requirements Manual Indian Point Unit 2 Control Room Narrative Logs Indian Point Unit 2 Plan of the Day

Section 1R01: Adverse Eleather Protection

Procedures

2-AOP-FLOOD-1, Flooding, Rev. 6
IP-SMM, Event Notification and Reporting, Rev. 11
OAP-008, Severe Weather Preparations, Rev. 7 Condition Reports (CR-lP2-)2010-07288

Miscellaneous

lP-RPT-04-00230, Indian Point Unit 2 Probabilistic Safety Assessment, Rev.Operator Control Room Logs, December 1 ,2010

Section 1R04: Equipment

Alisnment Procedures
2-COL-4.1.1, Component Cooling System, Rev. 24 2-COL-27.3.1, Diesel Generators, Rev. 25 2-COL-27.6, Unit2 Appendix R Diesel Generator, Rev. 00 Condition Reports (CR-lP2-)2010-06246
2010-06268
2010-06534
Drawinqs D253798, Emergency Diesel Generator Starting Air to Diesel #22, Rev. 3 D253801, Emergency Diesel Generator Lube Oil to Diesel #22, Rev. 5 D253804, Emergency Diesel Generator Jacket Water to Diesel #22, Rev. 6

Section 1R05: Fire Protection

Procedures

EN-DC-161, Control of Combustibles, Rev. 4 lP2-RPT-03-00015, lP2 Fire Hazards Analysis, Rev. 2 Attachment

Condition Reports

(CR-lP2-)201 0-06830 Pre Fire Plan

PFP-216, General Floor Plan - Fan House -72'0",80'0", 88'0" and 90'0" Elevations, Rev. 0
PFP-252A, Battery Rooms - Control Building - 33'0" Elevation, Rev. 0
PFP-260, Chemical Additive Room - Auxiliary Feedwater Building - 32'6" Elevation, Rev. 0
PFP-261, Auxiliary Feedwater Building - 43'0" and 53'0" Elevations, Rev. 0
PFP-262, Auxiliary Feedwater Building - 64'0' and77'0" Elevations, Rev.0

Section 1R06: Flood Protection

Measures Procedures
2-AOP-FLOOD-1, Flooding, Rev. 6
OAP-008, Severe Weather Preparations, Rev. 7 Condition Reports (CR-l P2-)2010-06872
2010-07033

Work Orders

255970 Miscellaneous

Design Basis Document

for 480 Volt Electrical System, Rev. 1 lndividual Plant Examination for External Events for Indian Point Unit 2 lP-RPT-04-00230, lndian Point Unit 2 Probabilistic Safety Assessment, Rev. 1 Safety Evaluation Report - Susceptibility of Safety-Related Systems to Flooding From Failure of Non-Category

I Systems, Indian Point Unit 2, August 21, 2001 System Health Report, 480 Volt, 2no Quarter 2010

Section 1R07: Heat Sink Performance

Procedures

SEP-SW-001, NRC Generic Letter 89-13 Service Water Program, Rev. 3 Condition Reports (CR-lP2-)2010-06245
2010-06247

Work Orders

52031271
52231423
52231424 Miscellaneous
GL 89-13, Service Water System Problems Affecting Safety-related Equipment

Section 1Rl1: Licensed Operator Requalification

Prooram Procedures
2-AOP-INST-1, InstrumenVController Failures, Rev. 6 2-AOP-RSD-1, Rapid Shutdown, Rev. 3 2-AOP-SG-1, Steam Generator Tube Leak, Rev. 11 2-E-0, Reactor Trip or Safety Injection, Rev. 3 2-E-2, Faulted Steam Generator lsolation, Rev. 0 Attachment
2-E-3, Steam Generator Tube Rupture, Rev. 1 2-POP-2.1, Operation at Greater Than 45o/o Power, Rev. 57 Condition Reports (CR-lP2-)2008-05504
2010-06029
2010-06049
2010-06064
2010-06068

Miscellaneous

EN-TQ-201, Systematic Approach to Training Process, Rev. 13
EN-TQ-202, Simulator Configuration Control, Rev. 7
EN-TQ-114, Licensed Operator Requalification Training Program Description, Rev. 3
EN-TQ-210, Conduct of Simulator Training, Rev. 3 IPEC Simulator Evaluated Scenario, Lesson
LRQ-SES-35, Rev. 2 LRQ Sample Plan for 2009 Comprehensive Written Exam LRQ Sample Plan for 2010 Annual Operating Exam
OAP-032, Operations Training Program, Rev. 11 Simulator Maintenance and Testino O-TQ-SM-106, 2009 Core Performance Test, Rev 4
DR 2010-0040, Reactor Trip Comparison to Simulator Response Simulator Steady State Test 14.03.03.01

,2010 Steady State Operability Test, Rev 1 Simulator Normal Operations Test 1 4.3.7 .2,2010 Reactor Startup, Rev 1 Simulator Surveillance Test

PT-M45, 2010 Containment Sump Pumps, Rev 1 Simulator Malfunction Test 14.04 .07 .19.01 , 2010 Area Rad. Monitor Failure, Rev 0 Simufator Malfunction Test 14.04.07.17.11,2010
RCS Flow Transmitter Failure, Rev 0 Simulator Transient Test 1 4.3.9.13,2010
LOCA with Blackout, Rev 4 Simulator Transient Test 14.3.9 .14,2010 Pzrr PORV Fails Open without High Head, Rev 4

Section 1R12: Maintenance

Effectiveness

Procedures

O-LUB-401-GEN, Lubrication of Plant Equipment, Rev. 8 2-E-3, Steam Generator Tube Rupture, Rev. 1 2-SOP-5.4.1, Vapor Containment Pressure Reliefs, Rev. 17 2-VLV-001-AOV, Fisher 10" Butterfly Valve Maintenance for
PCV-1190, 1191 and 1192, Rev.2
EN-DC-205, Maintenance Rule Monitoring, Rev. 2
EN-MP-100, Critical Procurements, Rev. 8
OAP-1 15, Operations Commitments and Policy Details, Rev. 1 1 Completed

Procedures

2-PT-Q013-DS149,
PCV-1 1 90,
PCV-1 191 ,
PCV-1 192,
SOV-1 279, and
SOV-1280 IST Data Sheet, Rev.26 Condition Reports (CR-lP2-)2006-04723
2006-06322
2008-04145
2010-03795
2010-03829
2010-03881
2010-04007
2Q10-04038
2010-04290
2010-04333
2010-04395
2010-04480
2o1o-04747
2010-04762
2010-04830
2010-04935
2010-05118
2010-05458
2010-05519
2010-05694
2010-05696
2010-05697
2010-06658
2001-10724

Work Orders

00164445
00239756 002425Q1 Attachment Drawinqs 9321-F-2017, Flow Diagram - Main Steam, Rev. 84 Miscellaneous Critical Procurement Plan for 21 Reactor Coolant Pump Motor Replacement in 2R19 LO-CAR-2010-00081
Maintenance Rule Basis Document Main Steam, Rev. 2 Maintenance Rule Basis Document for Reactor Coolant System, Rev. 2 Operational Decision Making Instruction for
RCP-21 Upper Oil Reservoir Elevated Bearing Temperatures, June 29, 2010 Reactor Coolant Pump 21 Upper Thrust Bearing Temperature Trend, June 23, 2010 *September
2,2010 R&G Laboratories, Oil Analysis Severity for Reactor Coolant Pump 21, August 11,2010 System Health Report - HVAC - Central Control Room, 2nd Quarter 2010

Section 1Rl3: Maintenance

Risk Assessments and Emerqent Work Control Procedures
EN-WM-104, On Line Risk Assessment, Rev. 1 lP-SMM-101, Online Risk Assessment, Rev. 3
OAP-008, Severe Weather Preparations, Rev. 6 Condition Reports (CR-lP2-)2010-Q6274

Miscellaneous

Operator Narrative Logs, October 13, 2010 Operator Narrative Logs, October 14,201Q Operator Narrative Logs, November 4, 2010 Operator Narrative Logs, November 1 4,2010 Operator Narrative Logs, December 1 ,201Q Operator's Risk Report, October 13,2010 Operator's Risk Report, October 14,2010 Operator's Risk Report, November 4,2010 Operator's Risk Report, November 14,201Q Operator's Risk Report, December 1,2010

Section 1Rl5: Operabilitv

Evaluations

Procedures

2-PT-V072.
In-Service Test Relief Valve Tests, Rev. 2
EN-OP-104, Operability Determination Process, Rev. 4
EN-MA-133, Control of Scaffolding, Rev. 6 Condition Reports (CR-lP2-)2010-03667
2010-05501
2010-05505
2010-05669
2010-05670
2010-05671
2Q10-06248
2010-06267
2010-06423

Work Orders

244302
52256617 2010-05522
2010-05633
2010-05650
2010-05928
2010-05790
2010-05979
201 0-0661 9 Attachment Drawinqs 9321-F-2722, Flow Diagram - Service Water System, Rev. 125 Miscellaneoqg System Health Report - Service Water, 2no Quarter 2010

Section 1Rl8: Plant Modifications

Procedures

2-ARP-003, Diesel Generator, Rev. 8 2-SOP-27.3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 23 2-TOP-016,22
Emergency Diesel Generator Performance Test, Rev. 0
EN-DC-136, Temporary Modifications, Rev. 5 Condition Reports (CR-)1P2-2006-07329
1P2-2010-04711

tP2-2010-06260

lP3-2010-02924

Work Orders

247503
52268854 MiscellaneoUs

\P2-2UA-06052

tP2-2010-06246

lP-CALC-06-00329, Replacement of Emergency Diesel Generator Air Start Motors, Rev. 1 Standing Order 06-04, Emergency Diesel Generator Starting Air Pressure, December 27, 2006

Section 1Rl9: Post-Maintenance

Testinq Procedures
2-PT-2Y008B,22
Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 4 2-PT-2Y045A,21
Service Water Pump Full Flow Test, Rev. 2 2-PT-M021B, Emergency Diesel Generator
2Load Test, Rev. 19 2-SOP-27 .3.1.2, 22 Emergency Diesel Generator Manual Operation, Rev. 23 2-SOP-27.6, Unit 2 Appendix R Diesel Generator Operation, Rev. 6 lP-EP-1 15, Emergency Plan Forms, Rev. 27 lP-EP-AD4O, Equipment lmportant to Emergency Response, Rev. 5lP-EP-310, Dose Assessment, Rev. 10lP-RPT-07-00018, lP2 lnservice Test Program, Rev. 0 IPEC Emergency Plan, Revision 09-01 IPEC Unit 2 Technical Requirements Manual lP-EP-115, Emergency Plan Forms, Revision 27 lP-EP-310, Dose Assessment, Revision 10 lP-EP-AD4O, Equipment lmportant to Emergency Response, Revision 5 Completed

Procedures

2-PC-EM29, Wide Range Gas Effluent Radiation Monitor R-27 Transfer Calibration, Rev. 8, November 10,2010 2-PT-2Y0088.,22
Emergency Diesel Generator Mechanical Overspeed Trip, Rev. 4, October 12,2010 2-PT-2Y043, Appendix R DG Rated Load Test, Rev. 0, October 8,2010 2-PT-2Y045A,21
Service Water Pump Full Flow Test, Rev. 2, October 27,2010 2-PT-MO21B, Emergency Diesel Generator Load Test, Rev. 19, October 13, 201Q Work Order 52215Q74,24
Service Water Pump 480V Breaker, October 29,201Q Attachment

Condition Reports

(CR-lP2-)2010-05621

2010-06052
2010-06209
2010-06685
2010-06696
2010-06716
2010-06246
2010-06260
2010-06417
2010-Q6718
2010-06721
2010-06722

Work Orders

00202596
00249703
52262112
52268693
52215074
52246863
52273344
52255456
52255457 Drawinos 9321-F-2722, Flow Diagram, Service Water System, Rev. 125 D262583, Steam Generator Narrow Range Level -
CH.2, Rev. 5 Miscellaneous Contingency Action for Determining

a Release While R-27 is Out of Service for E-Plan Purposes (dated November 3, 2010)Interim Guidance for When Radiation Monitor R-27 is Out of Service for Declaring an Emergency Action Level (EAL) (dated November 24,2010)

Section 1R20: Refuelinq

and Outaqe Activities Completed

Procedures

2-PT-V53, Mode Change Checklist, Mode 3 to Mode 2, Rev. 7, November 22,2Q1Q lP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 18,2010 Procedures
2-POP^1.2, Reactor Startup, Rev. 55 2-POP-1.3, Plant Startup fromZeroTo
45o/o Power, Rev. 82 2-POP-2.1, Operation at Greater Than 45% Power, Rev. 57 2-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 54 2-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75
EN-OM-123, Fatigue management Program, Rev. 3 Condition Reports (CR-lP2-)2010-06764
2010-06801

Work Orders

00255970
00256247 Miscellaneous EmpCenter Fatigue Management Software Outage Schedule for 21Main Transformer Replacement, November 9, 2010

Section 1R22: Surveillance

Testinq Completed

Procedures

0-SOP-LEAKRATE-001, RCS Leakrate Surveillance, Evaluation and Leak ldentification, Rev. 1, December 4.2010 0-SOP-LEAKRATE-001, RCS Leakrate December 5, 2010 0-SOP-LEAKRATE-001, RCS Leakrate December 12,2010 Surveillance, Evaluation and Leak ldentification, Rev. 1, Surveillance, Evaluation and Leak ldentification, Rev. 1, Attachment
2-PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 7, September 17,2008 2-PT-Q013, Inservice Valve Tests, Data Sheet 43, Rev. 45, October 19,2010 2-PT-Q017C, Alternate Safe Shutdown Supply Verification to 23 CCP, Rev. 1 1 , September
1, 2010 2-PT-Q028A, 21 Residual Heat Removal Pump, Rev. 18, October 18,2010
PC-2Y1, RCS Alternate Safe Shutdown Temperature Monitor Calibration, Rev. 6, May 22,2008 Procedures
2-OSP-4.1.2, Support Procedure - Component Cooling System Operation, Rev. 4 2-SOP-4.1.2, Component Cooling System Operation, Rev. 35 Condition Reports (CR-lP2-)2008-02757
2010-05446
2010-05695
2010-05822
Drawinqs A227968, D/C for Alternate Safe Shutdown System Source Range Monitor Hot and Cold Leg Resistance Temperature Detectors, Rev. 4

Section 1EP6: Drill Evaluation

Procedures

2-AOP-INST-1, InstrumenVController Failures, Rev. 6 2-AOP-RSD-1, Rapid Shutdown, Rev. 3 2-AOP-SG-1, Steam Generator Tube Leak, Rev. 1 1 2-E-0, Reactor Trip or Safety Injection, Rev. 3 2-E-2, Faulted Steam Generator lsolation, Rev. 0 2-E-3, Steam Generator Tube Rupture, Rev. 1 2-POP-2.1, Operation at Greater Than 45% Power, Rev. 57 Miscellaneous
IPEC Simulator Evaluated Scenario, Lesson
LRQ-SES-3S, Rev. 2 Sections 2RS1/2RS2:
Radioloqical Hazard Assessment and Exposure Controls/Occupational
ALARA Planninq and Gontrols Procedures
EN-RP-101, Access Control for Radiological Controlled Areas, Rev. 5
EN-RP-105, RadiologicalWork Permits, Rev. 9
EN-RP-110, ALARA Program, Rev. 7
EN-RP-1 10-01. ALARA lnitiative Deferrals Condition Reports (CR-lP2)2010-1165
2010-1336
2010-1640
2010-1905 2010-1940
2010-2055
2010-2817
2010-2822 2010-3864
2010-4746
2010-6119 2010-1932
2010-1933 2010-2997
2010-3300 Condition Reports (CR-l P3)tP3-2010-1995

Miscellaneous

QA-14115-2009-lP-1, Quality Assurance Audit of IPEC Radiation Protection and Radwaste Attachment Section 4OA1 : Performance Indicator Verification

Procedures

EN-LI-114, Performance Indicator Process, Rev. 4 Miscellaneous Barrier Integrity Indicator Consolidated Data Entry Reports - Reactor Coolant System Leakage, October 2009 - September
2010 Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Cooling Water Support, October 2009 - September
2010 Mitigating Systems Performance Indicator Consolidated Data Entry Reports - Heat Removal, October 2009 - September
2010 Operator Narrative Logs, October 2009 - September
2010

Section 4OA2: ldentification

and Resolution of Problems Procedures

EN-Ll-102, Corrective Action Process, Rev. 15
EN-Ll-121, Entergy Trending Process, Rev. 8
EN-MA-102, Inspection Program, Rev. 3 and 4
EN-OP-115, Conduct of Operations, Rev. 9
EN-QV-100, Conduct of Nuclear Oversight, Rev. 4
EN-QV-109, Audit Process, Rev. 16
EN-QV-109-02, Audit Process Guidance, Rev. 0
EN-QV-1 1 1, Training and Certification of InspectionA/erification and Examination Personnel, Rev.8
EN-QV-117, Oversight Training Program, Rev. 9
EN-QV-119, Corrective Action Requests, Supplier Stop Work Orders, and Recommendations, Rev.6
EN-QV'123, Supplier Audits/Surveys, Rev. 3
EN-QV-128, Assessment of Nuclear Oversight, Rev. 2
EN-QV-129, Vulnerability Review Process, Rev. 1
OAP-O17, Plant Surveillance and Operator Rounds, Rev. 6
OAP-046, Operator Burden Program, Rev. 1 Technical Specifications Waterford Unit 3, 6.3 Unit Staff Qualifications Arkansas Nuclear One -1, 5.3 Unit Staff Qualifications Arkansas Nuclear One -2,6.3 Unit Staff Qualifications Grand Gulf, 5.3 Unit Staff Qualifications Indian Point 2, 5.3 Unit Staff Qualifications Indian Point 3, 5,3 Unit Staff Qualifications River Bend, 5.3 Plant Staff Qualifications Vermont Yankee, 5.3 Plant Staff Qualifications James A. Fitzpatrick, 5.3 Unit Staff Qualifications Palisades Nuclear Plant, 5.3 Unit Staff Qualifications Pilgrim Nuclear Power Station, 6.2 Unit Staff Qualifications

Condition Reports

(CR-)ANO-1-2009-02330

ANO-C-2009-01884
ANO-2010-01503
ANO-1 -201Q-01724
ANO-1 -2010-00743
ANO-1-2010-01080
ANO-C-2009-02608
ANO-2-2010-00028
[[::JAF-2010-03280|JAF-2010-03280]]
HQN-2010-00415
HQN-2010-00333
HQN-2010-00123
HQN-2010-00109
HQN-2010-00068
HQN-2010-00063
HQN-2010-00045
HON-2010-00060
HQN-2009-01198
HQN-2009-01194
HQN-2010-00594
HQN-2009-01171
HQN-2009-01153

rP2-2009-05393

tP2-2009-05399

tP2-2009-05400

rP2-2009-05389

rP2-2009-05349

rP2-2009-05348

tP2-2009-A$21

tP2-2010-04215

tP2-2010-04524

tP2-2010-05163

PLP-2009-05909
PLP-2010-02012
PLP-2009-05908
PNP-2009-05303
PNP-2009-05297
PNP-2010-02124
RBS-2010-01472
RBS-2010-02033
RBS-2010-00200
RBS-2010-0Q221
RBS-2010-00278
RBS-2010-00088
RBS-2010-00011
RBS-2009-06520
RBS-2009-06539

wF3-2010-00284

wF3-2009-07713

wY-2009-04496

wY-2010-01479

wY-2010-02759

cGS-2009-06921

GGS-2009-06922

cGS-2009-06923

GGS-2009-06927
GGS-2009-06806
GGN-2010-00164
ANO-1-2010-01182
[[::JAF-2008-03648|JAF-2008-03648]]
HQN-2010-00111
HQN-2009-00178
HQN-2009-01083
HQN-2009-01084
HQN-2009-01085
HQN-2009-01091
HQN-2009-01093
HQN-2009-01096
HQN-2009-01140
HQN-2009-01150
HQN-2009-01169
HQN-2009-01170
HQN-2009-01184

tP2-2010-04085

lP3-2010-01740

tP2-2010-03985

tP2-2010-03986

tP2-2010-03988

lP2-2010-03984

tP3-2009-04903

tP3-2009-04905

tP2-2010-04396

tP2-2010-04547

PLP-2009-04108
PLP-2009-05613
PLP-2009-05918
PNP-2009-01798
PNP-2009-02059
PNP-2009-02255
PNP-2008-00916
RBS-2010-00006
RBS-2009-06472
RBS-2009-06495
RBS-2009-06456
RBS-2009-06450
RBS-2009-06452
R85-2009-06158
RBS-2009-06209
RBS-2009-06449

wF3-2009-07711

wF3-2010-02629

wY-2010-04432

wY-2010-04434

GGN-2010-04140
GGN-2010-02730
GGN-2010-04178
GGN-2010-04101
GGN-2010-04092
GGN-2010-03674
GGN-2010-03721
ANO-1-2010-00719
[[::JAF-2009-04592|JAF-2009-04592]]
HQN-2009-01188
HQN-2009-01197
HQN-2010-00013
HQN-2010-00386
HQN-2010-00571
HQN-2010-00593
HQN-2010-00515
HQN-2010-00550
HQN-2010-00511
HQN-2010-00510
HQN-2010-00475
HQN-2010-00499
HQN-2010-00338

tP3-2009-04917

rP3-2009-04920

tP3-2009-04897

tP2-2009-05404

rP2-2009-05409

lP3-2009-04868

rP3-2009-04883

tP3-2009-04884

tP2-2010-04457

tP2-2010-04864

PLP-2010-02288
PLP-2010-02290
PLP-2009-05942
PNP-2008-03922
PNP-2009-05359
PNP-2010-00015
RBS-2008-04685
RBS-2009-05041
RBS-2009-06123
RBS-2009-06446
RBS-2009-06451
RBS-2009-06471
RBS-2009-06473
RBS-2009-06490
RBS-2010-00044

wF3-2010-01198

wF3-2010-01356

wF3-2010-00746

wY-2010-04496

wY-2010-00070

GGN-2010-02135
GGN-2010-02382
GGN-2010-02902
GGN-2010-00590
GGN-2010-01247
GGN-2010-Q1252
GGN-2009-06575
GGN-2009-06904
GGN-2009-06910
GGN-2009-06505
ANO-2010-01503

Miscellaneous

Entergy Quarterly Trend Report, 2no Quarter 2010 Maintenance Rule (aX1) Systems List since December 2009 Operator Burdens Performance Indicator, November 2009 - October 2010 Operator Special Log Index, September
2010 - December 2010 Operator Work Arounds Performance Indicator, November 2009 - October 2010 EOI Letter,
ENOC-10-00002, Response to Request for lnformation, Rev. 1, January 8,2010 EOI Letter,
ENOC-09-00037, Response to Request for Information, November 30, 2010 QAPM, Entergy Quality Assurance Program Manual, Rev. 0 through 20 Regulatory Guide 1.8, Personnel Selection and Training, Rev. 1 ANSI/ANS 3.1-1978, American National Standard for Selection and Training of Nuclear Power Plant Personnel, 1978 ANSI N18.1-1971, American National Standard for Selection and Training of Nuclear Power Plant Personnel, 1971 NRC SER, NRC Safety Evaluation Report, "Entergy Operations, Inc. Quality Assurance Program Consolidation," November 6, 1998 Technical Specification, Unit Staff Qualifications, Various 5.3.1, Personnel Change Planning ChecklisVForms for QA Manager Candidates, July 2007 CEO2009-00195, Corporate
ANSI Level lll Surveillance of W Maintenance Inspection Program (VfY), December 15,2009 EOI Letter,
BVY 03-12, Vermont Yankee Nuclear Power Station, Docket No. 50-271, Annual Submittal of QAP Changes (WY), February 5, 2003
CIN-2003/00059, Vermont Yankee, 10 CFR Part 50.54(a)(3)
Change Review, April 24,2002 EOI Letter No.,
CNRO-2003-013, Forms for QAPM, Rev. 8 (VrY)EOI Letter No.,
CEXO-20031164, Entergy Quality Assurance Program Manual, Rev. 8 (VfY), April24,2OA3
EOI Letter No.,
CNRO-20021027,lssuance of Entergy Quality Assurance Program Manual (OAPM) Rev. 8 (\ffY), April24,2003
CFR 50.59, Review Form, Entergy Quality Assurance Program Manual, Rev. 7 (PNPS), April 25.2002 ENO Letter No., 1 .2.02-067, Entergy QA Program Manual, Rev. 7 (PNPS), May 2,20Q2
EN-QV-104, Attachment
9,1, Entergy QA Program Manual, Rev. 7 (PNPS), Independent Spent Fuel Storage Installation, July 30,2002 ENOC Letter No. 07-0020, Entergy QA Program Manual Change Review Form 50.54(a) Parts 1, 2 and 3 (PLP), April 5, 2007
AP-20.06, Attachment
1, Entergy QA Program Manual, Rev. 16, Annual Report 10
CFR 50.5a(a)(3)

and10 CFR72.140(d) (PLP), April 15,2007

MCM-4.1, Attachment
4.1, FSAR Change Request Form, Relocate QA Program from Chapter 17 to Entergy QAPM (JAF), May 6,2002
AP-20.09, Attachment
1, Nuclear Engineering
CFR 50.59 Screening Form (JAF), April 3, 2002 Entergy Letter,
JLIC-02-017, Process Applicability Screening - Relocate QA Program From FSAR Ch. 17 to Entergy QAPM (JAF), April 1 ,2002 ENO Letter ,1.2.02-060, Cross Reference of QAPM Commitments to lmplementing

Procedures

at JAF, April2, 20Q2 A-12 GGN-2010-03900

GGN-2010-03451
GGN-2010-03492
ANO-1-2010-00743
GGS-2009-06907
GGS-2009-06920
ANO-1-2009-02330
PLP-2009-05897
Entergy Letter,
CNRO-2002-027, Adaptation of Entergy Common QAPM, Rev. 7 (JAF), June 21, 2002 10
CFR 50.5a(a) Evaluation, Entergy QA Program Manual, Rev. 7 (JAF), April25,2002
ENO Letter 1.2.02-060, QA Program Change/Prior Approval Determination - Part A (lP3), May 6,2002 ENO Meeting Summary, Adaptation of Entergy Common QAPM, Rev. 7, (lP2 and lP3), June 21, 2002 Development of Common QA Manual for Northern Entergy Sites and Entergy Nuclear Generating Company Plants, November 30, 2001 Enqineerinq Chanqes/Maintenance

Work Orders

ANO-EC-07032
RBS-EC-00893
PLP-EC-05885
ANO-EC-02886
GGN-EC-o1452
PLP-EC-0g121
GGN-EC-00224
GGN-EC-02048
RBS-EC-03643
GGN-EC-02048
ANO-EC-08043
RBS-EC-03850
PLP-EC-18042
ANO-EC-00608
GGN-EC-13354
PLP-EC-06553
GGN-EC-o2107
GGN-EC-13355
RBS-EC-06947
GGN-EC-02110
RBS-EC-07239
GGN-EC-02201
RBS-EC-08504
GGN-EC-02784
RBS-EC-12204
GGN-EC-04538
RBS-EC-13128
GGN-EC-06299
RBS-EC-16451
GGN-EC-06301
RBS-EC-70752
GGN-EC-07471
RBS-EC-07368
GGN-EC-07716
RBS-EC-03852
GGN-EC-06875
RBS-EC-03853
GGN-EC-06039
RBS-EC-03975
GGN-EC-06086
RBS-EC-70733
GGN-EC-00494
Aud it Reports/Su rvei llances Corporate
ANSI Level lll Surveillance of W PNP Pre-NIEP 2009 Report PNP Pre-NIEP 2010 W Pre-NIEP 2007 LO-WYLO-2007-00029
Palisades Pre-NIEP 2009 Palisades
2008 Pre-NIEP Report JAF Pre-NIEP August 2007 IPEC Pre-NIEP 2009 IPEC 2008 Pre- NIEP Assessment
GGNS Pre-NIEP Report final May 2008 GGNS Pre-NIEP 2009 ANO Pre-NIEP 2010 WF3 Pre-NtEP 2007 W3 CEO2008-00026
QA-13-2009-PLP-01
PLP NIEP 2009
QA-13-2009-GGNS.1
GGNS NIEP 2OO9
QA-13-2007-)/Y-1
NIEP AUDIT REPORT NIEP - River Bend - 2007 JAF
QA 2008 NIEP Report RBS-EC-70734
RBS-EC-02692
ANO-EC-03069
PLP-EC-12392
GGN-EC-02065
GGN-EC-02058
RBS-EC-03275
WF3-EC-15451
PLP-EC-12731
ANO U-1
EC 01039 ANO U-1
EC 05808 ANO U-1
EC 13153 ANO U-1
EC 00380 ANO U-1
EC 05054 ANO U-1
EC 05388 ANO U-1 EC06241 ANO U-1
EC 07032 ANO U-1
EC 13224 WF3-EC-844881

wF3-EC-05854

VYT-EC-o3138
Inspection Program GGN-EC-o1450
GGN-EC-OOO85
RBS-EC-03275
ANO-EC-04461
PLP-EC-14181
GGN-EC-13326
GGN-EC-02065
RBS-EC-05932

wF3-EC-10706

WF3-EC-o1830

wF3-EC-07960

WF3-EC-01166

wF3-EC-09046

wF3-EC-00935

WF3-EC-01166

wF3-EC-01396

WF3-EC-01782
WF30EC-03013

wF3-EC-11284

WF3-EC-13981
IPEC 2009 NIEP Report WF3 NIEP 2OO8
QA-1 0-2006-VY-1
Maintenance
QA-1 0-2006-RBS-1
Maintenance
QA-1 0-2006-JAF-1
Maintenance
QA-1 0-2006-PNP-
Maintenance
QA-1 0-2006-l P-1 Maintenance
QA-1 0-2006-GGNS-1
Maintenance
QA-1 0-2006-ANO-1
Maintenance
QA-1 0-2006-WF3-1
Maintenance
QS-2010-PLP-017
PLP QC Inspection Program
QS-201O-GGNS-O11
GGNS QC Inspection Program
QS-2010-ECH-008
ANSI Level lll of IPEC
QS-2010-ECH-007
Review of EOC for QC Inspection Point Selection
QS-2010-ECH-006
Review of Fleet lnterim Actions
QS-2010-ECH-002
ANSI Level lll of PNP
OS-2010-ECH-001
ANSI Level lll of GGNS
QS-2009-VY-004
VY Inspection Program
QS-2009-VY-020
VY Maintenance Inspection Program
QS-2009-ANO-006
Corporate
ANSI Level lll of ANO
QS-2008-VY-004
Peer Inspector Qualification Documentation
QS-201 0-PNPS-01
PNP Inspection Program
QA-1 0-2008-VY-
Maintenance
QA-1 0-2008-RBS-1
Maintenance
QA- 1 0-2008-PNP-
Maintenance
QA-1 0-2008-PLP-1
Maintenance
QA-1 0-2008-JAF-1
Maintenance
QA-1 0-2008-lP-1
Maintenance
QA- 1 0-2008-GGNS-1
Maintenance
QA-1 0-2008-ANO-1
Maintenance
QA-1 0-2008-WF3-1
Maintenance

Section 4OA3: Event Follow-up Procedures

2-POP-3.1, Plant Shutdown from 45o/o Power, Rev. 54 2-POP-3.3, Plant Cooldown - Hot to Cold Shutdown, Rev. 75
EN-Ll-102, Corrective Action Process, Rev. 16 lP-SMM-OP-105, Post Transient Evaluation, Rev. 6 IPEC Emergency Plan, Revision 09-01 lP-EP-1 15, Emergency Plan Forms, Revision 27 lP-EP-120, Emergency Classification, Revision 4
IP-EP'210, Central Control Room, Revision 7 Completed

Procedures

lP-SMM-OP-105, Post Transient Evaluation, Rev. 6, November 19, 2010 Condition Reports (CR-lP2-)2c10-A7092

2010-5082 Attachment

Miscellaneous

Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated August 17,2010, Subject: Inspection of Dry Cask Components pertaining to stuck MPC condition from August 12,2010 Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated November 23,2010 Entergy letter from Clay Wilson, IPEC System Engineering, to Holtec International dated December 1,2010, Subject: lnspection of Dry Cask Components pertaining to stuck MPC condition from November 19.2010 Holtec International letter dated August 16,2Q10, to Tim Salentino, IPEC, and Thermal review of Stuck MPC condition at lP2 Holtec International letter dated August 18,2010, to Tim Salentino, IPEC, of MPC transfer at lP2 Holtec International letter dated November 24, 2010, to IPEC, containing the thermal and structural assessment of the stuck MPC condition at lP2 Holtec International

e-mail correspondence from Kevin Cuthill to Tim Salentino, IPEC, dated December 1,2010 IPEC Procedure Review and Approval Form lP-SMM-AD-102, Rev. 6, for Procedure

MPC Transfer &
HI-STORM Movement, No. 2-DSC-009-GEN, Rev. 8 IPEC Unit 2 Alert Report, November 7, 2010 (dated December 1, 2010)Audio tapes of the Radiological Emergency Communication System from November 7,2010 Software Change Request
SCR-2010-0432, for revising
MIDAS-USER-IPC
1.5.13.110
Standard Test Case MIDAS lnstallation Revision 3

Section 4OA5: Other Activities

Procedures

EN-Ll-102, Corrective Action Process, Rev. 15
EN-Ll-1 21, Entergy Trending Process, Rev. 8
EN-MA-102, Inspection Program, Rev. 3 and 4
EN-OP-115, Conduct of Operations, Rev. 9
EN-QV-100, Conduct of Nuclear Oversight, Rev. 4 Miscellaneous Technical Specification, Unit Staff Qualifications, Various Subject: Structural Subject: Resumption
ADAMS ALARA CA CAP CARB CCR CFR CR CRG CRS DG DRA DRP DRS EAL EDG EP EPIP ERO FRV FSB Holtec HRA tMc IPEC ISFSI JPM MBFP MPC NCV NEI NRC ODCM PCV PFP PI PMT PTRG QP RA RCS RECS RETS RO RSPS RWP SGI SI SRO SS A-16

LIST OF ACRONYMS

Agencywide

Document and Management

System As Low As Reasonably

Achievable

Corrective

Action Corrective

Action Program Corrective

Action Review Board Central Control Room Code of Federal Regulations

Condition

Report Condition

Review Group Control Room Supervisor

Diesel Generator Deputy Regional Administrator

Division of Reactor Projects Division of Reactor Safety Emergency

Action Level Emergency

Diesel Generator Emergency

Plan Emergency

Plan lmplementing

Procedure Emergency

Response Organization

Feed Regulation

Valve Fuel Storage Building Holtec International

High Radiation

Area Inspection

Manual Chapter Indian Point Energy Center Independent

Spent Fuel Storage Installation

Job Performance

Measures Main Boiler Feed Pump Multipurpose

Canister Non-Cited

Violation Nuclear Energy lnstitute, lnc.Nuclear Regulatory

Commission

Offsite Dose Calculation

Manual Pressure ControlValve

Pre-Fire Plan Performance

Indicator Post-Maintenance

Testi ng Post-Trip

Review Group Augmented

Quality Regional Administrator

Reactor Coolant System Radiological

Emergency

Communication

System Rad iolog ical Effluent Techn ical Specification

Reactor Operator Risk Significant

Planning Standard Radiation

Work Permit Safeguards

Information

Safety Injection Senior Reactor Operator Shift Supervisor

SSC [[]]
SWP [[]]
TRM [[]]
TS [[]]
UFSAR [[]]
URI [[]]
VHRA [[]]

WO A-17 Structure, System, and Component Service Water Pump Technical

Requirements

Manual Technical

Specifications

Updated Final Safety Evaluation

Report Unresolved

ltem Very High Radiation

Area Work Order Attachment