ML23331A980: Difference between revisions

From kanterella
Jump to navigation Jump to search
(StriderTol Bot change)
(StriderTol Bot change)
Line 17: Line 17:
=Text=
=Text=
{{#Wiki_filter:EXHIBIT 17 Exhibit 17 1
{{#Wiki_filter:EXHIBIT 17 Exhibit 17 1
The Cooling-Canal System at the FPL Turkey Point Power Station By David A. Chin, Ph.D., P.E., D.WRE, BCEE Professor of Civil and Environmental Engineering University of Miami Executive Summary This report was prepared under an agreement between Miami-Dade County and the University of Miami.
The following issues related to the operation of the cooling-canal system (CCS) at the Turkey Point Power Station were investigated: (1) temperature variations in the CCS and associated impacts on the surrounding groundwater, (2) salinity variations in the CCS and associated impacts on the surrounding groundwater, and (3) the effects of pumping up to 100 million gallons per day from the L-31E Canal into the CCS.
The principal findings of this investigation are summarized below, with analytical details supporting the findings contained in the body of the report. Data for this study was provided by the Miami-Dade County Department of Regulatory and Economic Resources. CCS temperature and salinity data for the four-year interval of 9/1/10 - 12/7/14 were made available for this investigation.
Temperature in the CCS. A heat-balance model was developed to simulate the temperature dynamics in the CCS. The results derived from the heat-balance model showed that there were two distinct periods during which the heat-rejection rate from the power plant remained approximately constant. The first period corresponded to pre-uprate conditions, and the second period corresponded to post-uprate conditions. The heat-rejection rate during the second period was found to be significantly greater than the heat-rejection rate during the first period. As a result of the increased heat addition to the CCS, the average temperature of water in the CCS has increased, and in the vicinity of the power-plant intake the average temperature has increased by approximately 2.6 C (4.7 F). This measured increase in average temperature within the intake zone is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2 C (4.0 F) that was approved by the Nuclear Regulatory Commission in 2014. Therefore, the increased maximum operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, which currently stands at 104 F. Since supplementary cooling of the CCS was needed in 2014, this serves as a cautionary note regarding further increases in power generation beyond 2014 levels without providing a reliable supplementary cooling system. Measured temperature data during the period of record indicate that the thermal efficiency of the CCS has decreased between the pre-uprate and post-uprate periods. Further investigation is recommended to confirm the decrease in thermal efficiency of the CCS and identify the causative factor(s). The assertion that higher algae concentrations in the CCS were responsible for the elevated temperatures in the CCS was investigated. A sensitivity analysis indicates that increased algae concentrations were not likely to have been responsible for the significantly elevated temperatures in the CCS recorded in the mid-summer months of 2014. The additional heating rate in the CCS caused by the presence of high concentrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the minimal impact. Further development of the heat-balance model is needed, since the design of any engineered system to control temperatures in the CCS must be done in tandem with heat-balance-model simulations.
Temperature impact on groundwater. Measured groundwater temperatures in some monitoring wells between the CCS and the L-31E Canal have shown higher temperatures than groundwater west of the L-31E


Exhibit 17 2
TheCooling-CanalSystemattheFPLTurkeyPointPowerStation
Canal, and this occurrence can be partially attributed to limited cooling-canal water intrusion into the Bis-cayne Aquifer. Monitoring-well measurements further show that nearly all of the seasonal temperature fluctuations in the groundwater occur above an elevation of 25 ft NGVD* (about 30 ft below the ground surface). At lower elevations in the aquifer, the groundwater temperature generally remains relatively steady and in the range of 75 F - 77 F (24 C - 25 C). Seasonal temperature fluctuations above 25 ft NGVD can be partially attributed to the heating and cooling of water in the L-31E Canal in response to seasonal changes in atmospheric conditions. Overall, the impact of CCS water on the temperature of groundwater in the Bis-cayne Aquifer can be considered as localized of not having any significant environmental consequence.
Salinity in the CCS. There has been a steady increase in CCS salinity of around 5 per decade since the CCS began operation in 1973. Recent measurements indicate that the rate of change of salinity might be increasing. Analyses of the salinity dynamics in the CCS were performed using a salinity model previously developed by a FPL contractor. Results from this salinity model show that evaporation and rainfall are the primary drivers affecting the salinity in the CCS, with pumpage from the interceptor ditch and blowdown from the Unit 5 generating facility also having an effect. Over prolonged periods with no rainfall, the salinity in the CCS will generally increase as fresh water is evaporated and the evaporated fresh water is replaced by saline water from the surrounding aquifer. A prolonged period with no rainfall was the primary cause for the unusually high salinities (greater than 90) that were observed in early summer of 2014. Seepage inflow to the CCS is mostly from the east (i.e., the area adjacent to Biscayne Bay) and seepage outflow of more saline water occurs primarily through the bottom of the CCS, thereby contributing to an increased salinity of the underlying groundwater. The short-term (seasonal) salinity fluctuations in the CCS are controlled by seasonal variations in the amount and timing of rainfall, and aperiodic spikes in salinity should be considered as being normal and expected. In the long term, barring any significant intervention, salinities will continue to follow an upward trend, since over the long term annual evaporation exceeds annual rainfall. Increased temperatures in the CCS lead to increased evaporation which increases the rate of change of salinity in the CCS above historical rates of change. The steady increase in salinity could be mitigated by an engineered system to add supplemental water with lesser salinity. However, pumping lower salinity water into the CCS in large quantities will elevate the water level in the CCS, decrease the seaward piezometric-head gradient, and likely exacerbate the inland intrusion of saltwater originating from the CCS. The effectiveness of an engineered system that pumps saline water from the CCS to deep-well(s) for disposal will depend on the groundwater-flow response in the aquifer surrounding the CCS, the induced salinity-transport dynamics within the aquifer, and the operational protocol of the deep-well injection system. Data in support of such a proposed system was not made available to the investigator during this study.
Salinity impact on groundwater. Based on available documentation and data summaries contained in numerous reports prepared by FPL, SFWMD, and DERM, there is little doubt that seepage from the CCS into the Biscayne Aquifer has caused salinity increases within the aquifer, and this impact extends several miles inland from the CCS. The strongest evidence for this assertion comes from the analysis of tritium data.
The CCS contains water with a high tritium concentration, and utilization of tritium as a tracer to identify groundwater originating from the CCS is justified. Elevated concentrations of tritium above a 20 pCi/L threshold in the deep groundwater can reasonably be attributed to the presence of water originating from the CCS. The approximate limit of the 20 pCi/L concentration contour has been reported to be 3.8 - 4.7 miles west of the CCS and 2.1 miles east of the CCS.
* NGVD  refers to the NGVD 29 datum.


Exhibit 17 3
ByDavidA.Chin,Ph.D.,P.E.,D.WRE,BCEE ProfessorofCivilandEnvironmentalEngineering UniversityofMiami
Withdrawal of 100 mgd from the L-31E Canal. Adverse impacts of pumping 100 mgd from the L-31E Canal into the CCS during June 1 - November 30 are likely to occur under the current permitted pumping protocol. Under the current pumping protocol stipulated in the SFWMD-issued permit, the stage in the L-31E Canal will be held constant during pumping, while the stage in the CCS will generally rise as a result of pumping. This combined effect will decrease, or possibly reverse, the seaward piezometric-head gradient between the L-31E Canal and the CCS that would normally exist in the absence of pumping. A possible consequence of a reversed head gradient between the L-31E Canal and the CCS is advection of a saline plume from the CCS towards the L-31E Canal, and creation of a circulation cell in which the salinity of the water in the L-31E Canal is increased as the saline plume enters the L-31E Canal. Furthermore, according to model results provided by FPL in support of the pumping-permit application, pumping of 100 mgd into the CCS is likely to reduce the water-level differential between the L-31E Canal and the CCS to below the 0.30 ft threshold that would normally trigger the operation of the interceptor ditch salinity-control system, which, if operational, would further reduce the head gradient between the L-31E Canal and the CCS. Based on these findings, it is recommended that the permitted pumping protocol be revised prior to the 2016 pumping period. The revised protocol should include, as a minimum, real-time monitoring of the stages in the CCS and the L-31E Canal during pumping operations, specification of a threshold water-level difference between the L-31E Canal and the CCS that would limit further pumping, and real-time monitoring of the salinity in the L-31E Canal during pumping operations.
Recommended actions. The following specific action items would lead to better and more efficient man-agement of the cooling-canal system:
* Develop a calibrated heat-balance model to simulate the thermal dynamics in the CCS, and collect the data necessary to calibrate and validate this model.
* Confirm and identify the causative factors for the decline in the thermal efficiency of the CCS between the pre-uprate and post-uprate periods.
* Develop a quantitative relationship for estimating algae concentrations in the CCS as a function of temperature, salinity, and nutrient levels.
* Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature, wind speed, salinity, and algae concentrations in the CCS.
* Modify the operational protocol associated with the 2015 - 2016 permit for transferring up to 100 mgd from the L-31E Canal to the CCS.
The analyses and recommendations contained in this report are offered in support of the goal of achieving an environmental balance for the sustainable generation of electrical power at the Turkey Point power station.


Exhibit 17 4
ExecutiveSummary
(This page is intentionally left blank.)


Exhibit 17 5
This report was prepared under an agreement between Miami-Dade County and the University of Miami.
Contents 1 Background                                                                                              6 1.1 Turkey Point Power Station . . . .  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 1.2 Geohydrology . . . . . . . . . . .  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 1.3 The Cooling-Canal System . . . .    . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 1.4 Algae in the CCS . . . . . . . . .  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 1.5 Saltwater Intrusion . . . . . . . .  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 1.6 L-31E Canal and Interceptor Ditch    . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 2 Temperature Variations in the Cooling Canals                                                          15 2.1 Results from Previous Studies . . . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . . . 15 2.1.1 Temperatures in the CCS . . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . . . 15 2.1.2 Thermal Efficiency of the CCS . . .    . . . . . . . . . . . . . . . . . . . . . . . . . . 16 2.1.3 Thermal Effects on Groundwater . .      . . . . . . . . . . . . . . . . . . . . . . . . . . 16 2.2 Heat-Balance Model of CCS . . . . . . . .      . . . . . . . . . . . . . . . . . . . . . . . . . . 17 2.2.1 Heat-Balance Model Formulation .        . . . . . . . . . . . . . . . . . . . . . . . . . . 17 2.2.2 Heat-Flux Components . . . . . . .      . . . . . . . . . . . . . . . . . . . . . . . . . . 18 2.2.3 Heat-Balance Equations . . . . . .      . . . . . . . . . . . . . . . . . . . . . . . . . . 22 2.2.4 Model Results . . . . . . . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . . . 23 2.2.5 Conclusions . . . . . . . . . . . . .  . . . . . . . . . . . . . . . . . . . . . . . . . . 27 3 Salinity Variations in the Cooling Canals                                                              28 3.1 Results from Previous Studies . . . . . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . 29 3.1.1 Historical Chloride Levels . . . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . 29 3.1.2 Historical Specific Conductance Levels      . . . . . . . . . . . . . . . . . . . . . . . . 30 3.2 Salinity-Balance Model of CCS . . . . . . . .      . . . . . . . . . . . . . . . . . . . . . . . . 30 3.2.1 Salinity-Balance Model Formulation . .      . . . . . . . . . . . . . . . . . . . . . . . . 30 3.2.2 Previous Model Results . . . . . . . .      . . . . . . . . . . . . . . . . . . . . . . . . 31 3.2.3 Analysis of Salinity Dynamics . . . . .    . . . . . . . . . . . . . . . . . . . . . . . . 32 3.2.4 Demonstration of Salinity Dynamics . .      . . . . . . . . . . . . . . . . . . . . . . . . 33 4 Pumping Water from the L-31E Canal into the Cooling Canals                                            34 4.1 Pumping Permit and Protocols . . . . . . . . . . . . . . . . . .    . . . . . . . . . . . . . . . 34 4.2 Quantitative Effects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 4.3 Model Results . . . . . . . . . . . . . . . . . . . . . . . . . . .  . . . . . . . . . . . . . . . 38 4.4 Environmental Effects . . . . . . . . . . . . . . . . . . . . . .    . . . . . . . . . . . . . . . 39 4.4.1 Effect of Increased Water-Surface Elevations in the CCS      . . . . . . . . . . . . . . . 39 4.4.2 Suggested Permit Modifications . . . . . . . . . . . . .      . . . . . . . . . . . . . . . 43 5 Conclusions and Recommendations                                                                        43
The following issues related to the operation of the cooling-canal system (CCS) at the Turkey Point Power Stationwereinvestigated: (1)temperaturevariationsintheCCSandassociatedimpactsonthesurrounding groundwater, (2) salinity variations in the CCS and associated impacts on the surrounding groundwater, and (3) the effects of pumping up to 100 million gallons per day from the L-31E Canal into the CCS.
The principal "ndings of this investigation are summarized below, with analytical details supporting the "ndings contained in the body of the report. Data for this study was provided by the Miami-Dade County Department of Regulatory and Economic Resources. CCS temperature and salinity data for the four-year intervalof9/1/10-12/7/14weremadeavailableforthisinvestigation.


Exhibit 17 6
Temperature in the CCS. A heat-balance model was developed to simulate the temperature dynamics in the CCS. The results derived from the heat-balance model showed that there were two distinct periods duringwhichtheheat-rejectionratefromthepowerplantremainedapproximatelyconstant. The"rstperiod corresponded to pre-uprate conditions, and the second period corresponded to post-uprate conditions. The heat-rejectionrateduringthesecondperiodwasfoundtobesigni"cantlygreaterthantheheat-rejectionrate duringthe"rstperiod. AsaresultoftheincreasedheatadditiontotheCCS,theaveragetemperatureofwater intheCCShasincreased,andinthevicinityofthepower-plantintaketheaveragetemperaturehasincreased by approximately 2.6C (4.7F). This measured increase in average temperature within the intake zone is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2C (4.0F) that was approved by the Nuclear Regulatory Commission in 2014. Therefore, the increased maximum operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, which currently stands at 104F. Since supplementary cooling of the CCS was needed in 2014, this serves as a cautionary note regarding further increases in power generation beyond 2014 levels withoutprovidingareliablesupplementarycoolingsystem. Measuredtemperaturedataduringtheperiodof recordindicatethatthethermalef"ciencyoftheCCShasdecreasedbetweenthepre-uprateandpost-uprate periods. Furtherinvestigationisrecommendedtocon"rmthedecreaseinthermalef"ciencyoftheCCSand identify the causative factor(s). The assertion that higher algae concentrations in the CCS were responsible for the elevated temperatures in the CCS was investigated. A sensitivity analysis indicates that increased algae concentrations were not likely to have been responsible for the signi"cantly elevated temperatures in the CCS recorded in the mid-summer months of 2014. The additional heating rate in the CCS caused by the presence of high concentrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the minimal impact. Further development of the heat-balance model is needed, sincethedesignofanyengineeredsystemtocontroltemperaturesintheCCSmustbedoneintandemwith heat-balance-modelsimulations.
1    Background This investigation is primarily focused on the operation of the cooling-canal system (CCS) located at the Turkey Point power-generating station in south Miami-Dade County, Florida. The issues of concern relate primarily to the increased temperatures and salinities that have recently been measured in the CCS, the envi-ronmental impacts of these increased levels on the quality of groundwater in the Biscayne Aquifer, the need for additional engineered systems to supply supplemental cooling water to the CCS, and the environmental impacts of permitted pumping of up to 100 mgd of water from the L-31E Canal to the CCS between June 1 and November 30.
Environmental concerns. Most of the environmental concerns regarding the operation of the cooling-canal system (CCS) at Turkey Point relate to: (1) the sustainability of the system in maintaining adequate temperatures to cool the power-generating units, (2) the impact that current and projected future salinities in the CCS have on the quality of groundwater in the surrounding Biscayne Aquifer, and (3) the need for new supplementary sources of water and/or revised operational protocols to control the temperatures and salinities in the CCS. Specific issues of concern are as follows:
* Increased temperatures in the CCS limit the effectiveness of the CCS as a cooling-water source ser-vicing four power-generating units. When the intake temperature in the CCS exceeds a regulatory limiting value of 104 F, either power generation must be curtailed or supplementary cooling water must be provided to the CCS to reduce the temperature and hence keep the generating units in op-eration; the sustainability of a supplementary system to cool the water in the CCS has not yet been established.
* Increased salinity in the CCS likely contributes to increased saltwater intrusion within the Biscayne Aquifer, thereby deteriorating the groundwater quality underlying inland areas. The current salinity-control system, sometimes called the interceptor-ditch system, has not been effective in controlling the inland migration of saline water from the CCS, thereby signaling the need for revised operating strategies to manage salinity intrusion resulting from CCS operation.
* The effectiveness of the permitted protocol for pumping 100 mgd from the L-31E Canal into the CCS to reduce temperatures in the CCS, and the effect of this pumping operation on saltwater intrusion in the Biscayne Aquifer and water quality within the L-31E Canal are issues that are yet to be resolved.
This report summarizes what is currently known about the CCS, summarizes key findings from previous related investigations, regulatory reports and reviews, provides new analyses, and gives suggested answers and pathways forward to resolve several issues related to the above-listed concerns.
1.1    Turkey Point Power Station The Turkey Point Power Station currently consists of five power-generating units: two 404-MW oil/natural gas-fired generating units (Units 1 and 2), two 728-MW nuclear-powered units (Units 3 and 4), and a nomi-nal 1150-MW natural gas-fired combined-cycle unit (Unit 5). In 2002, the Nuclear Regulatory Commission (NRC) extended the operating licenses for both nuclear reactors from forty years to sixty years, extending licensed operation to the year 2033. In June of 2009 the Florida Department of Environmental Protection (FDEP) issued certification for the increase in power-generating capacity (commonly called an uprate) of


Exhibit 17 7
Temperature impact on groundwater. Measured groundwater temperatures in some monitoring wells betweentheCCSandtheL-31ECanalhaveshownhighertemperaturesthangroundwaterwestoftheL-31E Exhibit 17
Units 3 and 4 to provide an additional 250 MW of power. Unit 3 has been operating at its uprated power-generation capacity since Nov 2012, and Unit 4 has been operated at its uprated power-generation capacity since May 2013. In planning for the Unit 3 and Unit 4 uprates, it was anticipated that the uprate would increase the temperature of the cooling water discharged to the CCS by 2.5 F (1.4 C), from 106.1 F to 108.6 F (41.2 C to 42.6 C) (FPL 2011), and that the increased temperature in the CCS might result in in-creased evaporation and increased salinity. The CCS provides cooling water for Units 1 to 4, with cooling of Unit 5 accomplished by mechanical-draft cooling towers that use make-up water drawn from the Upper Floridan Aquifer. Blowdown water from Unit 5 is discharged into the CCS. Since the uprate of Units 3 and 4 went into effect, Unit 2 has not been operational. In 2014, the Florida legislature approved construction of two additional nuclear reactors at Turkey Point (Units 6 and 7), with each additional unit having an ap-proximate electrical output of 1100 MW; approval of the additional units by the NRC is currently pending.
The two additional nuclear reactors will not use the CCS for cooling. Presently, with an estimated total power-station capacity of approximately 3550 MW, the Turkey Point power station is the second largest power station in Florida, in terms of generating capacity, and is the sixth largest power station in the United States (NRC, 2012).
1.2 Geohydrology The Turkey Point power station and associated cooling-canal system (CCS) are underlain by the Biscayne Aquifer. In the vicinity of Turkey Point, the Biscayne Aquifer extends from land surface to a depth of ap-proximately 106 ft below sea level (BSL), with the thickness of the aquifer decreasing towards the west.
Geologic formations within the Biscayne Aquifer include, from the ground surface downward, the Miami Limestone Formation, Key Largo/Fort Thompson Formations, and upper portions of the Tamiami Forma-tion. The less-permeable units of the Tamiami Formation, and the deeper Hawthorn Group, form the con-fining unit between the Biscayne Aquifer and the Upper Floridan aquifer. The top of the confining unit is characterized by the transition between highly permeable beds of the Fort Thompson Formation and the lower-permeability silty sands of the Tamiami Formation. The thickness of the Miami Limestone Formation is in the range of 8 - 23 ft, and the thickness of the Fort Thompson Formation is in the range of 46 - 95 ft.
The regional groundwater flow direction is, on average, from the northwest to southeast (Fish and Stewart 1991), although the predominant flow direction at the coast can vary significantly between the wet and dry seasons. The water-table gradient is typically towards the coast during the wet season (May - October),
but can be directed inland during the dry season (October - April). The possibility of the occurrence of an inland water-table gradient is the primary reason for the so-called interceptor-ditch system that is used ostensibly to control the inland migration of saline water originating from the CCS. Water-table elevations at Turkey Point are typically around 1 ft NGVD, and the magnitude of the average regional water-table gra-dient is typically in the range of 0.004% - 0.005%. Notably, with such small water-table gradients, small errors in measured water-table elevations can significantly impact the accuracy of the estimated gradients.
Vertical piezometric-head gradients at the Turkey Point site (away from the CCS) are typically negligible, with piezometric-head differentials between shallow, intermediate, and deep zones reportedly being within hundredths of a foot.
Groundwater classification. Groundwater at the Turkey Point site was originally classified by FDEP as as G-II, which is the classification for groundwater that is of possible potable use and has a total dissolved solids content of less than 10,000 mg/L. In September 1983, at the request of FPL, the groundwater at the Turkey Point site was reclassified by FDEP as G-III, which is the classification for groundwater that


Exhibit 17 8
2
has a total dissolved solids content of 10,000 mg/L or greater, or has a total dissolved solids of 3,000 -
10,000 mg/L and has no reasonable potential as a future source of drinking water. The G-III classification currently remains in effect.
1.3    The Cooling-Canal System History and regulation. Construction of the cooling-canal system (CCS) was approved by the Dade County Board of County Commissioners in November 1971, and became operational in February 1973. At the time of its initial operation, the CCS was approximately half-way completed compared with the present system. The CCS is sometimes referred to as an Industrial Wastewater Facility (IWW) since the circulating water system, which discharges saline water to the surrounding aquifer, is regulated under the federal Na-tional Pollutant Discharge Elimination System (NPDES) and an Industrial Wastewater (IW) permit issued to FPL by the Florida Department of Environmental Protection.
Current canal system. In its present state, the CCS is approximately two miles wide (east-west) and five miles long (north-south), covers an area of approximately 5900 acres, and has approximately 4370 acres of water surface. The CCS consists of 32 canals flowing south from the discharge location in the north, and 7 return canals flowing north to the intake location. Because the south-flowing canals are located in the western section of the CCS and the north-flowing canals are located in the eastern section of the CCS, the system is sometimes referred to as having 32 western canals and 7 eastern canals. The south-flowing (western) canals are each approximately 4 ft deep, 200 ft wide, and spaced approximately 90 ft apart; these canals range in length from 2 - 5 miles. The 4 ft depth of the canals (from ground surface) was originally chosen so as to not penetrate the less-permeable surficial Miami Oolite Formation that extends to about 4 ft below grade, thereby minimizing groundwater exchange between the CCS and the underlying Biscayne Aquifer. The bottom of the canals are below the lowest water-table elevation expected in the Biscayne Aquifer at Turkey Point, and therefore the canals always contain water that is directly connected to the adjacent groundwater. Cooling water leaves the four generating units (Units 1 - 4), flows into Lake Warren, and then into the 20-ft deep 100-ft wide feeder canal that connects to the 32 south-flowing cooling canals.
Four shallow cross canals spaced 1-mile apart run east - west across the 32 south-flowing cooling canals.
These cross canals contain flow-control structures that distribute water flow evenly to the canals so that each cooling canal carries a flow that is proportional to its surface area in order to optimize heat exchange with the atmosphere. At the southern end of the CCS is a collector canal that is approximately 20 ft deep and 200 ft wide. Water returns to the power-generating units from the southern collector canal via 6 north-flowing canals, the largest of which is the Card Sound Canal which is 200 ft wide and 20 ft deep. The average length of the circulation path between the discharge and intake locations is 13.4 miles. The 32 south-flowing cooling canals are numbered from 1 to 32, from east to west, hence, cooling-canal number 32 is the westernmost canal in the CCS. Endangered American crocodiles (Crocodylus acutus) inhabit the cooling canals. During nesting season, more than 40 adult crocodiles have been observed in the canals, although there have been some reports that the crocodile population in the CCS is declining possibly due directly or indirectly to the increased salinities in the CCS.
Operational characteristics. The canals in the CCS were designed to operate at a total flow rate of 4250 ft3 /s (2750 mgd) when all four generating units (Units 1 - 4) supported by the CCS are in full oper-ation. Small wastewater (blowdown) flows from Unit 5 are also discharged into the CCS. Typically, the flow rate through the CCS varies significantly with the electric load demand on the generating units, and is


Exhibit 17 9
Canal, and this occurrence can be partially attributed to limited cooling-canal water intrusion into the Bis-cayne Aquifer. Monitoring-well measurements further show that nearly all of the seasonal temperature "uctuations in the groundwater occur above an elevation of 25 ft NGVD* (about 30ft below the ground surface). Atlowerelevationsintheaquifer,thegroundwatertemperaturegenerallyremainsrelativelysteady and in the range of 75F-77F(24C-25C). Seasonal temperature "uctuations above 25 ft NGVD can bepartiallyattributedtotheheatingandcoolingofwaterintheL-31ECanalinresponsetoseasonalchanges inatmosphericconditions. Overall,theimpactofCCSwateronthetemperatureofgroundwaterintheBis-cayneAquifercanbeconsideredaslocalizedofnothavinganysigni"cantenvironmentalconsequence.
usually in the range of 2700 - 4250 ft3 /s (1750 - 2750 mgd) on any given day, with a typical flow depth of around 2.8 ft. Thermal energy is dissipated in CCS as water moves from north to south, with the primary heat-exchange processes being evaporation, solar radiation, and both emitted and absorbed longwave radia-tion. Maximum temperatures near the discharge location of the power-generating units are typically around 108 F (42 C), and maximum temperatures near intake to the power-generating units are typically around 93 F (34 C); the difference between these typical maxima is 15 F (8 C), which gives a measure of the cool-ing effect of the CCS. The (regulated) maximum allowable temperature at the intake location in the CCS is 104 F (40 C). The flow in the CCS is driven by 12 condenser-circulating pumps and auxiliary cooling pumps. The CCS typically contains approximately 7 x 108 ft3 of water, and the average velocity is around 0.25 ft/s in each canal. Approximately two days (44 - 48 h) are required for water in the CCS to travel from the discharge location to the intake location. Within the CCS, the flow is maintained by a head differential between the discharge and intake locations, with the water-surface elevation being highest at the discharge location and lowest at the intake location. The water level at the discharge location is typically about 3 ft higher than the water level at the intake location. Typical water surface elevations in the CCS are 2.04 ft NGVD at the discharge location, 0.76 ft NGVD at the south end, and 0.77 ft NGVD at the intake loca-tion. The water-surface elevation at south end of the CCS is usually closest to the water-surface elevation in Biscayne Bay. The water-surface elevation in the CCS is typically higher than the site-average water-table elevation in the Biscayne Aquifer at the discharge (north) end of the system, approximately equal to the water-table elevation at the south end of the system, and below the water table at the intake (north) end of the system. Consequently, water generally flows out of the CCS into the aquifer near the discharge location of the CCS and water generally flows into the CCS from the aquifer near the intake location of the CCS, there is less flow interaction between the CCS and the aquifer at the southern end of the system. During very heavy rains, there can be a net inflow to the CCS from the surrounding aquifer. The CCS is approximately nontidal, and water in the CCS is typically warmer than the air temperature. The effectiveness of the CCS as a cooling system decreases as the temperature in the CCS increases.
1.4 Algae in the CCS A significant algae bloom occurred in the CCS during 2014 and algae in now perceived to be a problem in the CCS. Prior to 2013, only limited and short-term algae blooms had occurred in the CCS, typically during the early summer months. In fact, algae blooms were of such limited concern that routine monitoring for algae was not commonly done prior to 2014. In the summer of 2014, large-scale application of a CuSO4 -
based algaecide was used to reduce the algae concentrations in the CCS. The applied algaecide was reported as being ineffective in reducing the algae concentrations, serving only to stabilize the existing concentrations (SFWMD, 2015).
Factors affecting algae concentrations. High concentrations of algae have been observed in the CCS with correspondingly high concentrations of nutrients being measured. The historical average algae concen-tration in the CCS is reported to be 50 cell/L , however, in the summer of 2014 algae concentrations as high as 1600 cell/L were reported (SFWMD, 2015). The addition of nutrients from the power-generating units into the CCS is assumed to be negligible, with nutrients likely originating from allochthonous sources. Total nitrogen (TN) concentrations in the CCS have been reported in the range of 1.7 - 5.3 mg/L (Ecology and Environment, Inc., 2012). The highest reported TN concentrations in the CCS were measured at all stations in March 2012, which coincided with higher turbidities and pH in the CCS. The majority of the nitrogen Algae concentrations are normally given in Chla/L, so these units are unusual.


Exhibit 17 10 in the CCS appears to be in organic form (typically 80% - 90%). Total phosphorus (TP) concentrations in the CCS have been reported in the range of 4 - 73 µg/L, with an overall average concentration of 36 µg/L.
SalinityintheCCS. TherehasbeenasteadyincreaseinCCSsalinityofaround5perdecadesincethe CCS began operation in 1973. Recent measurements indicate that the rate of change of salinity might be increasing. AnalysesofthesalinitydynamicsintheCCSwereperformedusingasalinitymodelpreviously developed by a FPL contractor. Results from this salinity model show that evaporation and rainfall are the primary drivers affecting the salinity in the CCS, with pumpage from the interceptor ditch and blowdown fromtheUnit5generatingfacilityalsohavinganeffect. Overprolongedperiodswithnorainfall,thesalinity intheCCSwillgenerallyincreaseasfreshwaterisevaporatedandtheevaporatedfreshwaterisreplacedby salinewaterfromthesurroundingaquifer. Aprolongedperiodwithnorainfallwastheprimarycauseforthe unusually high salinities (greater than 90) that were observed in early summer of 2014. Seepage in"ow to the CCS is mostly from the east (i.e., the area adjacent to Biscayne Bay) and seepage out"ow of more saline water occurs primarily through the bottom of the CCS, thereby contributing to an increased salinity of the underlying groundwater. The short-term (seasonal) salinity "uctuations in the CCS are controlled by seasonalvariationsintheamountandtimingofrainfall,andaperiodicspikesinsalinityshouldbeconsidered asbeingnormalandexpected. Inthelongterm,barringanysigni"cantintervention,salinitieswillcontinue to follow an upward trend, since over the long term annual evaporation exceeds annual rainfall. Increased temperatures in the CCS lead to increased evaporation which increases the rate of change of salinity in the CCS above historical rates of change. The steady increase in salinity could be mitigated by an engineered systemtoaddsupplementalwaterwithlessersalinity. However,pumpinglowersalinitywaterintotheCCS in large quantities will elevate the water level in the CCS, decrease the seaward piezometric-head gradient, and likely exacerbate the inland intrusion of saltwater originating from the CCS. The effectiveness of an engineered system that pumps saline water from the CCS to deep-well(s) for disposal will depend on the groundwater-"ow response in the aquifer surrounding the CCS, the induced salinity-transport dynamics withintheaquifer,andtheoperationalprotocolofthedeep-wellinjectionsystem. Datainsupportofsucha proposedsystemwasnotmadeavailabletotheinvestigatorduringthisstudy.
Numerous measurements of TN and TP have been reported between 7/2010 and 3/2015 (Ecology and Envi-ronment, Inc., 2010; 2011a; 2011b; 2012a; 2012b; 2012c; 2013a; 2013b; 2014a; 2014b; 2015), and synoptic measurements within this time period yield TN/TP values in the range of 48 - 2015 with a median value of 142. Since the measured TN/TP values generally exceed the Redfield ratio of 16, it can be inferred that TP is the controlling nutrient for algae growth in the CCS. The existence of TP control of algae growth in saline systems is commonly attributed to the presence of nitrogen-fixing planktonic cyanobacteria which make up any short-term nitrogen deficits (Howarth and Marino, 2006). It has been reported that the cyanobacteria Aphanothece sp. are the predominant algae species in the CCS; these species are nitrogen-fixing and thrive under hypersaline conditions. In addition to nutrients, both temperature and salinity are known to affect the growth of algae in water bodies. For given nutrient levels, increasing temperatures usually contribute to increased algae concentrations, and increasing salinities usually contribute to decreased algae concen-trations (Hakanson and Eklund, 2010). However, for the algae species commonly found within the CCS, algae concentrations have been reported to increase with increasing salinity (SFWMD, 2015). Algae con-centrations are usually expressed in terms of the mass of chlorophyll-a per liter. Synoptic measurements of chlorophyll-a (Chla) concentration, salinity (S), temperature (T ), and total phosphorus (TP) concentra-tion at locations near the discharge and intake locations in the CCS between May 31, 2015 and November 13, 2015 are plotted in Figure 1. These synoptic measurements collectively show the algae concentration Chlorophyll-a concentra!on (g/L) 400                                                          45                                                    120 Trend line Total Phosphorus (g/L)
Outlier Temperature (oC) 300                                                          40 80 200                                                          35 40 100                                                          30 0                                                          25                                                              0 20    40      60      80    100                        20      40      60        80  100                                  20  40      60        80  100 Salinity ()                                                Salinity ()                                                    Salinity ()
(a) Sta!on TPSWCCS-1B (near discharge)
Chlorophyll-a concentra!on (g/L) 400                                                          45                                                    120 Total Phosphorus (g/L)
Temperature (oC) 300                                                          40 80 200                                                          35 40 100                                                          30 0                                                          25                                                              0 20  40      60      80    100                          20  40      60      80  100                                20    40      60        80  100 Salinity ()                                                Salinity ()                                                    Salinity ()
(b) Sta!on TPSWCCS-6T (near intake)
Figure 1: Chlorophyll-a levels in the CCS as a function of temperature, salinity, and total phosphorus (Chla) decreasing with increasing salinity (S), decreasing with increasing temperature (T ), and decreasing


Exhibit 17 11 with increasing nutrient concentration (TP). All of these trends are contrary to the natural relationships be-tween Chla, S, T , and TP and are either anomalous or indicate the effect of an algaecide. Assuming that a CuSO4 -based algaecide was applied during the period of measurements, the effectiveness of the algaecide can be seen by plotting the relationship between Chla and sulfate (SO4 ) concentrations, and this relation-ship is shown in Figure 2. It is apparent from Figure 2 that algae concentrations decrease significantly with Chlorophyll-a concentra!on (g/L)                                                  Chlorophyll-a concentra!on (g/L) 400                                                                              400 300                                                                              300 200                                                                              200 100                                                                              100 0                                                                                0 2000      4000        6000        8000                                        2000    4000          6000        8000 Sulfate concentra!on (mg/L)                                                        Sulfate concentra!on (mg/L)
Salinity impact on groundwater. Based on available documentation and data summaries contained in numerous reports prepared by FPL, SFWMD, and DERM, there is little doubt that seepage from the CCS into the Biscayne Aquifer has caused salinity increases within the aquifer, and this impact extends several milesinlandfromtheCCS.Thestrongestevidenceforthisassertioncomesfromtheanalysisoftritiumdata.
(a) Sta!on TPSWCCS-1B (near discharge)                                              (b) Sta!on TPSWCCS-6T (near intake)
The CCS contains water with a high tritium concentration, and utilization of tritium as a tracer to identify groundwater originating from the CCS is justi"ed. Elevated concentrations of tritium above a 20pCi/L thresholdinthedeepgroundwatercanreasonablybeattributedtothepresenceofwateroriginatingfromthe CCS. The approximate limit of the 20 pCi/L concentration contour has been reported to be 3.8-4.7miles westoftheCCSand2.1mileseastoftheCCS.
Figure 2: Chlorophyll-a levels in the CCS sulfate concentrations increasing concentrations of algaecide (as measured by sulfate concentration), indicating that addition of an algaecide is an effective means of reducing algae concentrations in the CCS. However, it should also be kept in mind that Chla reductions caused by an algaecide are necessarily only temporary, since the natural factors causing high levels of Chla (i.e., S, T , and TP) remain at elevated levels within the CCS. Since the system is autotrophic, reduction of autochthonous TP levels should be targeted to ultimately reduce both algae levels and the need for repeated application of algaecide(s) in the CCS.
* NGVDreferstotheNGVD29datum.
Impact of increased algae concentrations. It has been asserted (SFWMD, 2015) that increased algae concentrations and turbidities associated with algae blooms cause more solar energy to be absorbed in the CCS, and reduces the ability of the CCS to dissipate thermal energy. The primary mechanisms by which the CCS dissipates thermal energy are by evaporation and the emission of longwave radiation. A conventional assumption made by engineers and scientists is that the evaporation rate from a water body is unaffected by the concentration of algae in the water body. There is no scientific evidence documented in any published studies showing that the rate of evaporation from a water body is reduced by high algae concentrations. Further, there are no published studies showing that the emission of longwave radiation from a water body is particularly sensitive to the concentration of algae in the water. As a consequence, the primary effect of increased algae concentrations in the CCS can be assumed to be increased absorption of solar radiation, which would increase the heating of the water and elevate the temperature of the water in the CCS. The quantitative effect of increased solar heating of the CCS due to increased algae concentrations is parameterized by a reduced albedo of the water surface, and the relationship between the reduced albedo and the corresponding increased temperature was investigated in this study using a heat-balance model described subsequently in Section 2.2 of this report. It should be noted that the trapping of solar energy due to increased algae concentrations would be moderated by the resulting increased evaporation which would cause increased cooling due to the extraction of the latent heat of vaporization.
Exhibit 17


Exhibit 17 12 1.5    Saltwater Intrusion The inland extent of saltwater intrusion in the Biscayne Aquifer is defined by the location of the 1000 mg/L isochlor. As a reference concentration, the South Florida Water Management District (SFWMD) defines seawater as having a chlorinity (i.e., chloride concentration) greater than 19,000 mg/L, and saline water as having a chlorinity greater than 250 mg/L. Surface waters with chlorinities greater than 1500 mg/L are classified as marine waters, and surface waters with chlorinities less than 1500 mg/L are classified as fresh waters (F.A.C. 62-302.200). The landward extent of the saltwater interface (i.e., the 1000 mg/L isochlor) varies naturally in response to a variety of factors, such as seasonal variations groundwater recharge and variations in rates at which groundwater is pumped from the aquifer. For example, prolonged droughts or excessive water usage inland that reduce water-table elevations can cause increased salinity intrusion. Prior to the construction of the CCS, the groundwater underlying the Turkey Point site was naturally saline due to the proximity of the site to the coast. In fact, had the groundwater not been saline, construction of the cooling-canal system at Turkey Point would not have been permitted. Since the water-table gradient towards the coast at Turkey Point is typically very low, and with the location of the saltwater interface being partially controlled by those gradients, even slight reductions of the fresh water piezometric-head gradient can cause substantial landward movement of the saltwater interface. The occurrence of landward gradients during the dry season promotes inland movement of saline groundwater.
3
CCS impact on saltwater intrusion. It has always been recognized that construction of the CCS without any mitigating salinity-control systems would cause the saltwater interface to move further inland. This expectation was based on the assertion that construction of a CCS containing saline water one mile inland from the coast is tantamount to moving the coast one mile inland, and also moving the associated saltwater wedge around one mile inland. Since water in the CCS has a higher salinity than seawater, and is therefore denser that the water in Biscayne Bay, the effect of the CCS is actually greater than moving the coast one mile inland. To compound this effect, the engineering consultants that originally analyzed the performance of the CCS also asserted that if the water level in the CCS were to be increased by 0.50 ft above the preconstruction water-table elevation, then the toe of saltwater water wedge at the base of the Biscayne Aquifer might move approximately 7.5 miles further inland during the dry season as compared to its original location during the dry season. The engineering consultants also asserted that in the wet season, an elevated water level of 0.50 ft in the CCS might move the toe of the saltwater wedge approximately 1 mile further inland compared to its original location during the wet season. Based partially on these expectations, the salinity-control system that is currently in place was designed to control the westward migration of saltwater originating in the CCS. This control system involves pumping water from a so-called interceptor ditch into the CCS in order to create a seaward hydraulic gradient between the L-31E Canal and the interceptor ditch, where the L-31E Canal is located to the west of the interceptor ditch. The protocol for operating this salinity-control system and the effectiveness of the system are discussed in Section 1.6 of this report.
Tracing the movement of CCS water in the Biscayne Aquifer. Tritium has been selected by the cog-nizant regulatory agencies (SFWMD and DERM) to trace the movement of CCS water in the Biscayne Aquifer. Historical data from 1974 to 1975 showed CCS tritium concentrations in the CCS to be in the range of 1556 - 4846 pCi/L, and reports submitted by FPL for the monitoring period from June 2010 through De-cember 2011 showed CCS tritium concentrations in the range of 1260 - 14,280 pCi/L. Natural groundwater at the base of the Biscayne Aquifer would be expected to have relatively low concentrations of tritium. A threshold concentration of 20 pCi/L has been used as a baseline to infer the presence of groundwater orig-


Exhibit 17 13 inating from the CCS. Groundwater with concentrations below 20 pCi/L are presumed not to be affected by the CCS. FPL does not concur with the selection of 20 pCi/L as a threshold or background tritium con-centration for surface water, pore water, or shallow groundwater. The basis of FPLs contention regarding the 20 pCi/L threshold is that multiple factors such as atmospheric deposition, vapor exchange, and errors in laboratory analysis can influence reported tritium levels. The FPL assertion is reasonable and is supported by measured data that indicate atmospheric and vapor exchange effects on tritium concentrations can be par-ticularly significant in surface water and shallow groundwater, with significance decreasing with distance from the CCS. However, at depth, the CCS appears to be the primary source of tritium, and using tritium as a tracer in the lower elevations of the Biscayne Aquifer is reasonable. Reported measurements show groundwater tritium concentrations in excess of 3000 pCi/L near the CCS, with concentrations decreasing with distance from the CCS, and found at concentrations of hundreds of pCi/L three miles west of the CCS at depth. The approximate limit of the 20 pCi/L concentration contour is 3.8 - 4.7 mi west of the CCS and 2.1 mi east of the CCS. Based on the strength of these data and supporting analyses, it is reasonable to con-clude that operation of the CCS has impacted the salinity of the Biscayne Aquifer within the limits of the 20 pCi/L contour.
Withdrawalof100mgdfromtheL-31ECanal. Adverse impacts of pumping 100mgd from the L-31E Canal into the CCS during June 1-November 30 are likely to occur under the current permitted pumping protocol. Under the current pumping protocol stipulated in the SFWMD-issued permit, the stage in the L-31ECanalwillbeheldconstantduringpumping,whilethestageintheCCSwillgenerallyriseasaresult ofpumping. Thiscombinedeffectwilldecrease,orpossiblyreverse,theseawardpiezometric-headgradient between the L-31E Canal and the CCS that would normally exist in the absence of pumping. A possible consequence of a reversed head gradient between the L-31E Canal and the CCS is advection of a saline plumefromtheCCStowardstheL-31ECanal,andcreationofacirculationcellinwhichthesalinityofthe waterintheL-31ECanalisincreasedasthesalineplumeenterstheL-31ECanal. Furthermore,accordingto model results providedby FPL in support of the pumping-permit application, pumping of 100mgd into the CCSislikelytoreducethewater-leveldifferentialbetweentheL-31ECanalandtheCCStobelowthe0.30ft threshold that would normally trigger the operation of the interceptor ditch salinity-control system, which, if operational, would further reduce the head gradient between the L-31E Canal and the CCS. Based on these"ndings,itisrecommendedthatthepermittedpumpingprotocolberevisedpriortothe2016pumping period. The revised protocol should include, as a minimum, real-time monitoring of the stages in the CCS andtheL-31ECanalduringpumpingoperations,speci"cationofathresholdwater-leveldifferencebetween the L-31E Canal and the CCS that would limit further pumping, and real-time monitoring of the salinity in theL-31ECanalduringpumpingoperations.
1.6    L-31E Canal and Interceptor Ditch L-31E Canal Levee L-31E and its adjacent 20-ft deep borrow canal to the west of the levee were primarily constructed as a barrier to prevent salinity intrusion to locations west of the canal. The L-31E Canal collects water from other drainage canals in the area that include Military Canal, North Canal, Florida City Canal, North Model Land Canal (C-106), and South Model Land Canal (C-107). The L-31E Canal discharges into Biscayne Bay through structures S-20 and S-20F in the vicinity of Turkey Point. The L-31E Canal was constructed in the late 1960s by the U.S. Army Corps of Engineers and the Central and Southern Florida Flood Control District (CSFFCD), where the CSFFCD was later renamed the South Florida Water Management District (SFWMD).
Interceptor ditch control system. The interceptor-ditch (ID) salinity-control system was designed to prevent the seepage of water from the CCS westward within the Biscayne Aquifer. The ID, which is located immediately to the west of the CCS, is occasionally pumped to create a seaward water-table gradient between the L-31E Canal to the west and the ID to the east, with the basis for the effectiveness of the ID control system being that groundwater originating in the CCS will be prevented from migrating towards the west in the presence of an eastward water-table gradient between the L-31E Canal and the ID. The ID is pumped when a natural seaward water-table gradient between the L-31E Canal and the ID does not exist, and usually this is needed only during the dry season (November - April). The ID is adjacent and parallel to cooling-canal number 32 (CC-32) at the western end of the CCS, and was constructed at the same time as the CCS.
The ID is approximately 18 - 20 ft deep, 30 ft wide, and 29,000 ft (5.5 mi) long. Within the ID are two pump stations, with each station containing two pumps, each capable of pumping up to 15,000 gpm (21.6 mgd).
There is no mechanism to transfer water between the ID and CCS, except for the 4 pumps at the two pump stations. The L-31E Canal, ID, and CC-32 are all approximately parallel to each other and run at an angle of approximately 17 38 west of south. The perpendicular horizontal distance between the L-31E Canal and the ID is about 1000 ft. When the ID is pumped, there is a quick and measurable response in water levels in the L-31E Canal and the monitoring wells closest to the ID, indicating that there is good connectivity between the ID, L-31E Canal, and nearby monitoring wells.


Exhibit 17 14 Interceptor ditch operating rule (1973 - 2011). The ID operating rule that was followed from the initial date of operation of the CCS in February 1973 up until December 2011 (i.e., for 38 years) was as follows:
Recommendedactions. Thefollowingspeci"cactionitemswouldleadtobetterandmoreef"cientman-agementofthecooling-canalsystem:
* Whenever the water-surface elevation in the L-31E Canal is more than 0.2 ft higher than the water-surface elevation in CC-32, there is a seaward water-level gradient and no pumping is necessary.
* Developacalibratedheat-balancemodeltosimulatethethermaldynamicsintheCCS,andcollectthe datanecessarytocalibrateandvalidatethismodel.
* If the above criterion is not met, a seaward gradient is still taken to exist if the water-surface elevation in the L-31E Canal is more than 0.3 ft higher than the water-surface elevation in the ID. Under this condition no pumping is necessary.
* Con"rmandidentifythecausativefactorsforthedeclineinthethermalef"ciencyoftheCCSbetween thepre-uprateandpost-uprateperiods.
* If neither of the above two criteria are met, pumping of the ID is initiated and the pumping rates are adjusted to meet the 0.3-ft water-level difference criterion between the L-31E Canal and the ID.
* Develop a quantitative relationship for estimating algae concentrations in the CCS as a function of temperature,salinity,andnutrientlevels.
* Pumping is terminated when the criteria for a natural water-table gradient is met (without pumping).
* Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature,windspeed,salinity,andalgaeconcentrationsintheCCS.
Although this operating rule is no longer in effect, it is still relevant to this analysis since possible westward migration of saline water from the CCS into the Biscayne Aquifer could have occurred while following this operating rule. This concern is discussed subsequently.
* Modifytheoperationalprotocolassociatedwiththe2015-2016permitfortransferringupto100mgd fromtheL-31ECanaltotheCCS.
Interceptor ditch operating rule (2011 - present). A more conservative revised operating rule for the ID was initiated in December 2011 that considered freshwater piezometric-head equivalents rather than measured water-table elevations. This resulted in changes to the ID operating rule, and since December 2011 the ID operating rule in effect is as follows:
* If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is equal to or greater than 0.30 ft then no pumping of ID is necessary, and a seaward gradient exists.
* If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is less than 0.30 ft, a natural seaward gradient might still exist if the L-31E Canal water-surface elevation mi-nus the ID water-surface elevation is equal to or greater than 0.30 ft and the density of the water in the ID is less than or equal to 1012 kg/m3 . If a density in the ID is greater than 1012 kg/m3 , a higher elevation difference between L-31E and the ID is necessary and can be calculated by converting the surface-water levels to freshwater piezometric-head equivalents.
* If a natural seaward gradient does not exist, create an artificial seaward gradient by pumping the ID until the ID is maintained at an elevation difference of at least 0.30 - 0.70 ft between the L-31E Canal and the ID, depending on the density of the ID water.
The primary change between this revised operating rule and the previous operating rule is the increase in the L-31E/ID/CC-32 water-level difference criteria and the consideration of variable-density effects. The use of freshwater piezometric-head equivalents provides a more rigorous approach to the operation of the ID.
Effectiveness of the ID salinity-control system. Both the current and previous operating rules of the ID salinity-control system have limited salinity-control effects and do not prevent the landward migration of saline water originating from the CCS under all conditions. Following either of these operating rules, pumping of the ID reduces the water level in the ID below that in the L-31E Canal thereby creating a seaward water-table gradient and presumably precluding westward migration of groundwater originating in the CCS.
However, pumping water from the ID into the CCS generally elevates the water-surface in the CCS and it is


Exhibit 17 15 possible for the water level in the CCS to be above the water level in the L-31E Canal, which then creates the possibility that water originating in the CCS could pass under the ID even when the pumps in the ID are running to prevent this occurrence. Interestingly, this scenario was recognized in an early report prepared by the design engineers (Dames and Moore, 1971) based on results derived from an analog model of the system. The analog model showed that westward migration of the saltwater interface is possible even if the ID operating rule is followed. Further, Golder (2008) stated that operation of the ID salinity-control system would prevent westward migration of CCS water at least in the top 18 ft of groundwater. Measurements taken during ID pumping have in fact shown several occurrences where the water level in the CCS exceeds that in the L-31E Canal during ID pump operation, thereby indicating the possible ineffectiveness of the ID salinity-control system. In actuality, the functioning of the ID salinity-control system is more accurately characterized as intercepting shallow saline groundwater adjacent to the ID that is then pumped back to the CCS when the natural gradients are low and the potential for saltwater intrusion exists. It is possible that pumping of the ID under some circumstances simply creates a shallow subsurface (groundwater) circulation in which water from the CCS flows into the ID as groundwater that is subsequently returned to the CCS as pumped water. In support of this assertion, time series plots show that there are periods during pumping of the ID when the bottom-water temperatures in the ID rose along with an increase in specific conductance in the ID (Ecology and Environment, Inc., 2014). Aside from concerns regarding the effectiveness of the ID control system in mitigating saltwater intrusion, secondary concerns have also been raised that the ID control system contributes to the deterioration of groundwater quality in that it generally pumps less-saline water from the ID into the hypersaline CCS which further contributes to increased salinity in the aquifer.
Theanalysesandrecommendationscontainedinthisreportareofferedinsupportofthegoalofachievingan environmentalbalanceforthesustainablegenerationofelectricalpowerattheTurkeyPointpowerstation.
2    Temperature Variations in the Cooling Canals The temperature in the CCS at the intakes to the power-generating units affect the efficiency and power output of the generating units that use water from the CCS. Both the efficiency and the power output of the generating units decrease with higher cooling-water temperatures. The practical upper limit of the intake cooling-water temperature is determined by the characteristics of the condensers and auxiliary heat exchangers in the generating units. In 2014 the Nuclear Regulatory Commission granted FPLs request to increase the maximum intake cooling-water temperature from 100 F to 104 F (37.8 C to 40 C). If the intake cooling-water temperatures in the CCS were to exceed 104 F, then FPL would be required to reduce power output and possibly shut down one or more of the power-generating units. Since this occurrence would adversely affect a large number of customers in the South Florida service region, Miami-Dade County is obliged to work with FPL to find ways to avoid cutbacks in power generation resulting from elevated temperatures in the CCS.
Exhibit 17
2.1 Results from Previous Studies 2.1.1 Temperatures in the CCS Water temperatures in the CCS are almost always higher than synoptic temperatures of the overlying air, and temperatures in the CCS are almost always higher than temperatures in nearby Biscayne Bay. Analyses done by FPLs engineering consultants in around 2008 anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 2.5 F (1.4 C) in the cooling water discharged to the CCS and an increase of 0.9 F (0.5 C) in the temperature of the intake water (reported in SFWMD, 2008). These temperature changes were predicted to result in an increase in evaporation from the CCS of around 2 -


Exhibit 17 16 3 mgd, and the increased evaporation was expected to increase the salinity in the CCS by 2 - 3. In contrast to the aforementioned predictions, it has been generally reported that temperatures in the CCS have actually increased by 5 - 9 F (3 - 5 C) in the post-uprate period compared with the pre-uprate period. In the summer of 2014 (during the post-uprate period), temperatures in the CCS were sufficiently elevated as to prompt concern regarding the sustainability of the CCS as an adequate source of cooling water to the power-generating units. According to FPLs consultant (Ecology and Environment, Inc., 2014), the increase in CCS water temperatures in the post-uprate period cannot be attributed to the uprate since the total heat rejection rate to the CCS from Units 1, 2, 3, and 4, operating at full capacity prior to the uprate would have been higher than the post-uprate heat rejection rate to the CCS for Units 1, 3, and 4, operating at full capacity. Unit 2 in the post-uprate period has been dedicated to operate in a synchronous generator mode and hence not producing steam heat.
4
2.1.2 Thermal Efficiency of the CCS The thermal efficiency of the CCS is a measure of the ability of the CCS to cool the discharged water down to the background air temperature. An investigation of the thermal efficiency of the CCS was performed by Lyerly (1998), and these analyses indicated that the thermal efficiency of the CCS at the time of the study was equal to 86.4%. This efficiency was based on a 24-h average discharge temperature of 107.3 F (41.8 C), average intake temperature of 91.1 F (32.8 C), and an average air temperature of 88.6 F (31.4 C).
In analyzing the temperature measurements, Lyerly (1998) noted that most of the cooling (i.e., most of the temperature decrease) occurs as the water in the CCS flows from the (north) discharge location to (south) collector canal, with much less temperature decrease as the water flows back from the collector canal to the (north) intake location. It is expected that the thermal performance varies with flow rate and the state of the CCS, so the reported thermal efficiency should be regarded more as a snapshot of conditions at the time of the measurements than as a constant value. More recent measurements between June 2010 and June 2012 (Ecology and the Environment, 2012) show water temperatures in the CCS on the discharge side of the power-generating units being around 13.5 F (7.5 C) warmer on average than at the intake side of the power-generating units. The average temperature at the south end of the CCS was only 2 F (1.1 C) warmer than at the intake side of the power-generating units, which supports the assertion that most of the cooling in the CCS occurs as the water flows from north to south.
2.1.3 Thermal Effects on Groundwater Measured groundwater temperatures in some wells between the ID and the L-31E Canal show higher tem-peratures than the groundwater west of the L-31E Canal, and this occurrence has been partially attributed to limited cooling-canal water intrusion (Dames and Moore, 1977). A groundwater thermocline has been reported to exist in the area west of the CCS, which shows a sudden decrease in groundwater temperature at a particular depth in the aquifer. Measurements show that nearly all of the seasonal temperature fluc-tuations occur above an elevation of 25 ft NGVD. Below 25 ft NGVD, the groundwater temperature generally remains in the range of 75 F - 77 F (24 C - 25 C). The seasonal temperature fluctuations above 25 ft NGVD have been attributed to the heating and cooling of water in the L-31E Canal in response to seasonal changes in atmospheric conditions. Notably there is some temperature stratification in the L-31E Canal, in part due to the canal depth and limited flow. The near-surface water temperatures in the L-31E Canal are almost always warmer than the bottom temperatures, and the surface temperatures exhibit more daily variability in response to air temperature changes. Aside from the groundwater adjacent to the L-31E


Exhibit 17 17 Canal, it has also been reported (Ecology and Environment, Inc., 2014) that since groundwater in monitor-ing wells TPGW-2M and TPGW-2D is warmer than other nearby surface waters such as Biscayne Bay or fresh groundwater, the CCS might be influencing the groundwater temperatures in those wells. Based on the aforementioned evidence, it can be concluded that the environmental effects of elevated groundwater temperatures due to the operation of the CCS are inconsequential.
(Thispageisintentionallyleftblank.)
2.2  Heat-Balance Model of CCS To fully understand the temperature dynamics in the CCS, it is necessary to have a validated heat-balance model of the CCS. In reviewing the documentation made available for this investigation, all indications were that such a model does not currently exist, at least not in the public domain. Historical documentation shows that a heat-balance model was developed in the early stages of operating the CCS, as reported by Ray L. Lyerly Associates (1973), however, utilization of this model has not been subsequently reported.
Exhibit 17
As described by Lyerly (1973), the heat-balance model that was developed previously took into account such key components as the heat entering the water from the power-generating units, the net heat entering the water from shortwave solar radiation and longwave atmospheric radiation, and the latent heat transfer associated with evaporation. The input variables in the thermal model were the air temperature, relative humidity, wind velocity, and the net amount of radiation; the output variable was the water temperature in the CCS.
2.2.1 Heat-Balance Model Formulation To investigate and understand the thermal dynamics within the CCS, a preliminary heat-balance model of the CCS was developed for this study. The CCS was divided into four zones as shown in Figure 3, where water in the CCS flows sequentially through zones 1, 2, 3, and 4. The four delineated zones are the same TPSWCCS-1                        Power Genera!ng HG Units Zone 1 Cooling Canal System Zone 4 TPSWCCS-2 TPM-1                TPSWCCS-5 Zone 2 Zone 3 TPSWCCS-4 Figure 3: Cooling-canal system zones that are used in salinity-balance model of the CCS developed by the engineering consultant for FPL.


Exhibit 17 18 The measurement stations that characterize conditions within each of the four CCS zones were taken as TPSWCCS-1, TPSWCCS-2, TPSWCCS-4, and TPSWCCS-5, respectively, and the approximate locations of these measurement stations are shown in Figure 3. The average-daily temperature measurements within each of the CCS zones in the period 9/1/10 - 12/7/14 are shown in Figure 4. It is apparent from these 50 Measured Temperature (oC) 40 30 20 10 Zone 1  Zone 2  Zone 3  Zone 4 0
5
9/1/2010    9/1/2011          9/1/2012          9/1/2013  9/1/2014 Figure 4: Temperature measurements in CCS measurements that the temperatures in the CCS decrease noticeably from zones 1 to 3 (i.e., moving from north to south in the CCS), with much less temperature change as the water moves back to the northern (cooling-water intake) end of the CCS through zone 4. Therefore, almost all of the cooling in the CCS occurs in the south-flowing canals in the western portion of the CCS. It is further apparent from the temperature measurements shown in Figure 4 that the midsummer temperatures in 2014 (between July and August) were higher than the midsummer temperatures in previous years. For the period of record (9/1/10 - 12/7/14), the maximum measured daily-average temperature in Zone 1 was 113 F (44.9 C) recorded on 8/21/14, and the maximum measured daily-average temperature in Zone 4 was 101 F (38.3 C) recorded on 8/22/14. Since the maximum allowable temperature at the cooling-water intake is 104 F and measured temperatures in Zone 4 have been close to this limiting value (e.g., 101 F recorded on 8/22/14), there is cause for concern.
Temperatures in Zone 4 near the 104 F limit could force curtailment of power generation by one or more of the power-generating units, and cause power outages in South Florida. Given the elevated temperatures that have been recorded in the CCS, is necessary to identify the fundamental reasons for these occurrences, and to determine whether such occurrences are expected to continue in the future without any changes in the CCS and/or power-plant operations. To fully understand the temperature dynamics in the CCS it was necessary to develop a heat -balance model of the CCS, which is described in the following section.
2.2.2 Heat-Flux Components The heat fluxes within each of the CCS zones are illustrated in Figure 5, where the volumetric inflow rate and temperature are Q1 and T1 , respectively, and the corresponding quantities on the outflow side are Q2 and T2 .
Within each zone, there are several sources of energy that are represented in Figure 5. These energy sources In this report heat and thermal energy are used interchangeably.


Exhibit 17 19 La              Rh              Rs        Rs Lw  Ch                Eh Q1, T1                                                                Q2, T2 CCS Zone (1)Rs Gh Figure 5: Energy fluxes in CCS zone and their quantification are described below, where, for consistency with thermodynamic convention, energy added to CCS is taken as positive and energy losses are taken as negative.
Contents
Absorbed solar radiation, (1  )Rs . The incident solar (short-wave) radiation is represented by Rs [EL2 T1 ]§ ,
and the albedo (i.e., reflectivity) of the water surface is represented by  [dimensionless]; therefore the amount of solar radiation that is absorbed within the zone is (1  )Rs . The average solar radiation, Rs , for each day in the four-year study (9/1/10 - 12/7/14) was obtained from the Florida Automated Water Network (FAWN) station located on the premises of the University of Florida Tropical Research and Education Center (TREC) in Homestead, Florida. The albedo, , of a water surface is typically on the order of 0.1 for latitudes in the range of 20 - 30 (Cogley, 1979), and a value of 0.1 was used as a reference value for this investigation. Factors such as the concentration of algae in the CCS can affect the value of , and therefore the sensitivity of the temperature dynamics within the zone to elevated algae concentrations was investigated by varying . The minimum value of  is equal to zero, in which case all of the incident solar radiation is absorbed by the CCS and none is reflected.
Hence,  was varied within the range of 0 - 0.1.
Evaporation heat flux, Eh . Evaporation extracts heat from the CCS due to the latent heat of evaporation required to transform water from the liquid phase to the vapor phase. The evaporation heat flux, Eh [EL2 T1 ], is given by Eh = Ef Lv                                              (1) where E [LT1 ] is the evaporation rate, f [ML3 ] is the density of fresh water, and Lv [EM1 ]
is the latent heat of vaporization of water. The evaporation rate of water has long been known to decrease with increasing salinity (e.g., Harbeck, 1955; Salhorta et al., 1985). In the present study, daily evaporation rates, E, were calculated based on typical salinities in the CCS, measurements of water temperature, Ts [], at the monitoring station within the zone, onsite measurements of air temperature, Ta [] and relative humidity, RH [dimensionless] at station TPM-1, and measurements of wind speed, Vw , at station TD. The freshwater density, f , in Equation 1, was taken as 994 kg/m3 ,
which is the approximate density of fresh water at 35 C (95 F). The latent heat of vaporization, Lv , in Equation 1, is known to depend on both the temperature and salinity of the source (liquid) water. At a temperature of 35 C, values of Lv at salinities of 60 and 80 are 2.279 MJ/kg and 2.229 MJ/kg, respectively (Sharqawy et al., 2010), and an average of 2.254 MJ/kg was used for Lv in the energy analysis. The empirical formula used for estimating E [cm/d], from onsite meteorological
  § Terms in square brackets indicate dimensions: E = energy, L = length, M = mass, T = time, and  = temperature.


Exhibit 17 20 measurements is E =  Cw (0.299 + 0.11Vw ) [es (Ts )  RH es (Ta )]                          (2) l          {z          }
1 Background 6 1.1 TurkeyPointPowerStation................................... 6 1.2 Geohydrology.......................................... 7 1.3 TheCooling-CanalSystem................................... 8 1.4 AlgaeintheCCS........................................ 9 1.5 SaltwaterIntrusion....................................... 12 1.6 L-31ECanalandInterceptorDitch............................... 13
                                                =f (Vw )
where Cw [dimensionless] is a calibration constant, f (Vw ) = Cw (0.299 + 0.11Vw ) is a wind function that accounts for the effect of wind on evaporation, Vw is the wind speed in m/s,  [dimensionless] is a factor that accounts for the effect of salinity on the saturation vapor pressure of water, and es (T ) [kPa]
is the saturation vapor pressure of water at temperature T . Equation 2 was used to calculate the evaporation for the sake of consistency with the previously developed salinity model of the CCS, where the constants Cw and  were taken as 0.69 and 0.885, respectively. In the salinity model, the value of Cw was determined by calibration, and the value of  was obtained from previous research on evaporation from saline water bodies reported by Salhorta et al. (1985). The evaporation formula given by Equation 2 has an uncertain functional form, particularly for the wind function f (Vw ).
Uncertainty in the wind function. Wind functions used to estimate evaporation typically have the form f (Vw ) = a + bVw , where a and b are constants. Such a wind function is used in Equation 2.
In artificially heated waters, vertical convection is particulary important under low-wind conditions making specification of the value of a a key parameter. The wind function used in Equation 2 was originally proposed by Williams and Tomasko (2009) for heated waters, however, alternate formula-tions have been proposed by others (e.g., Brady et al., 1969; Ryan and Harleman, 1973). Notably, the formulation proposed by Ryan and Harleman (1973), and subsequently supported by Adams et al.
(1975), accounts for the effect of the temperature difference between the heated water and the overly-ing air in specifying the convection parameter a in the wind function, which is a logical relationship that is not accounted for in the other models (including the model used in this study) and could be an important consideration in accounting for convective heat transfer at low wind velocities.
Rainfall heat flux, Rh . Rainfall that is cooler than the water in the CCS extracts thermal energy from the CCS because thermal energy in the CCS water is used to warm the rainwater. The heat flux, Rh [EL2 T1 ] due to rainfall directly on the CCS can be estimated using the relation Rh = f cpf dr (Ts  Tr )
where f [ML3 ] and cpf [EM1 1 ] are the density and specific heat of the (fresh) rainwater, re-spectively, dr is the depth of rainfall, Ts [] is the temperature of the water in the CCS, and Tr [] is the temperature of the rainfall. There are no direct measurements of rainfall temperature at the Turkey Point site, however, it can be estimated that during a rainfall event the ambient air can be cooled by several degrees, and the temperature of raindrops approaches that of the cooled ambient air. Cooling effects of rainfall on the ambient air have been reported to be as high as 10 C (Byers, 1949). On a global average, raindrops can have temperatures in the range of 32 F - 80 F (0 C - 27 C). For pur-poses of the present analysis, the temperature of the rainfall, Tr , was assumed to be 68 F (20 C), and the corresponding values of f and cpf were taken as 998 kg/m3 and 4.180 kJ/kg* C, respectively. The temperature dynamics in the CCS zones are relatively insensitive to the assumed temperature of the rainfall.
Atmospheric longwave radiation, La . Any body of matter whose temperature is above absolute zero emits longwave radiation. Longwave radiation, La [W/m2 ] emitted by the atmosphere can be estimated us-


Exhibit 17 21 ing the relation (Chin, 2013)
2 TemperatureVariationsintheCoolingCanals 15 2.1 ResultsfromPreviousStudies................................. 15 2.1.1 TemperaturesintheCCS................................ 15 2.1.2 ThermalEf"ciencyoftheCCS............................. 16 2.1.3 ThermalEffectsonGroundwater............................ 16 2.2 Heat-BalanceModelofCCS.................................. 17 2.2.1 Heat-BalanceModelFormulation........................... 17 2.2.2 Heat-FluxComponents................................. 18 2.2.3 Heat-BalanceEquations................................ 22 2.2.4 ModelResults..................................... 23 2.2.5 Conclusions....................................... 27
La = (Ta + 273)4 (0.6 + 0.031    RH es (Ta )(1 RL )
where  is the Stefan-Boltzmann constant (= 4.903 x 109 MJ*m2 K4 d1 ), Ta [ C] is the air tem-perature, RH [dimensionless] is the relative humidity, es (Ta ) [mm Hg] is the saturation vapor pressure of water at temperature Ta , and RL is the longwave reflection coefficient that can be taken as 0.03.
On cloudy days, atmospheric longwave radiation can be the greatest source of thermal energy at the water surface.
Water longwave radiation, Lw . Water in the CCS also emits longwave radiation by virtue of its temper-ature being greater than absolute zero. Longwave radiation, Lw [W/m2 ] emitted by the water in the CCS can be estimated using the relation (Chin, 2013)
Lw = (Ts + 273)4 where  is the emissivity of water that can be estimated as 0.97 [dimensionless],  is the Stefan-Boltzmann constant as given previously, and Ts [ C] is the temperature of the water in the CCS.
Heat interchange with surrounding aquifer, Gh . The CCS exchanges heat with the surrounding aquifer via seepage of groundwater into and out of the CCS, and conduction of heat between water in the CCS and groundwater in the surrounding aquifer. It is to be expected that the region immediately surrounding the CCS is normally cooler than the water in the CCS, in which case there will be cooling of the CCS water due to heat conduction between the CCS and the surrounding aquifer, cooling due to seepage inflow from the surrounding aquifer into the CCS, and no cooling or heating due to seepage outflow from the CCS into the surrounding aquifer. The cooling heat flux due to conduction can be assumed to negligible compared to the heat flux due to seepage inflow. The heat flux Gh [EL2 T1 ]
due to seepage inflow is proportional to the temperature difference between the water in the CCS and the groundwater in the surrounding aquifer and can be estimated by the relation Qsg Gh = g cpg        Tsg As where g [ML3 ] and cpg [EM1 1 ] are the density and specific heat, respectively, of the groundwa-ter surrounding the CCS, Qsg [L3 T1 ] is the seepage inflow to the CCS from the surrounding aquifer, As [L2 ] is the area of the CCS zone, and Tsg [] is the difference between the temperature in the CCS, Ts [], and the temperature on the surrounding groundwater, Tg [] (i.e., Tsg = Ts  Tg )
Conduction heat flux, Ch . The conduction heat flux is associated with the sensible transfer of heat be-tween the CCS water and the air above the CCS. The conduction heat flux, Ch [W/m2 ] can be esti-mated using the empirical relation (Chin, 2013; Chapra, 1997)
Ch = cB f (Vw ) (Ts  Ta )
where cB is Bowens coefficient, and f (Vw ) is the wind function as defined in Equation 2. Following the guidance given in Chin (2013) and Chapra (1997), the value of cB can be estimated as 0.063.
According to Martin and McCutcheon (1998), sensible heat transfer from lakes and reservoirs to the overlying air due to conduction and convection is a relatively small component of the heat balance


Exhibit 17 22 equation that is poorly understood, and Brown and Barnwell (1987) have noted that the conduction heat flux from lakes and reservoirs to the overlying air calculated by heat-transfer theory is normally small enough to neglect. Given the aforementioned considerations, conduction of heat between the CCS and the overlying air was neglected in this analysis.
3 SalinityVariationsintheCoolingCanals 28 3.1 ResultsfromPreviousStudies................................. 29 3.1.1 HistoricalChlorideLevels............................... 29 3.1.2 HistoricalSpeci"cConductanceLevels........................ 30 3.2 Salinity-BalanceModelofCCS................................ 30 3.2.1 Salinity-BalanceModelFormulation.......................... 30 3.2.2 PreviousModelResults................................ 31 3.2.3 AnalysisofSalinityDynamics............................. 32 3.2.4 DemonstrationofSalinityDynamics.......................... 33
Based on the component heat fluxes described above, the net heat flux, HC [EL2 T1 ], into the CCS is given by 4 {                                                    }
HC =        [(1  )Rs + Eh + Rh + La + Lw + Gh ]i Ai                            (3) i=1 where i is an index that refers to each zone within the CCS, Ai [L2 ] is the area of Zone i, and the summation is over the four zones within the CCS. The areas of each of the zones in the CCS are given in Table 1, and the total area of the CCS is approximately 1907 ha (= 4712 ac). The heat extracted from the CCS by pumping Table 1: CCS Zonal Areas in Energy and Salinity Models Area Zone    (ha) 1      368.0 2     795.1 3     396.6 4      347.0 Total  1906.7 cooler water from the ID into the CCS was calculated in a similar manner to the method used to calculate the cooling effect of rainfall, where the effective rainfall rate is equal to the volume of water pumped from the ID divided by the area of the CCS. Assuming (conservatively) that the temperature difference between the ID water and the CCS water is 10 C (50 F), the cooling effect of pumped ID water was found to be negligible compared with other component fluxes in the heat-balance equation.
2.2.3 Heat-Balance Equations Under steady-state conditions, conservation of thermal energy requires that the net rate at which heat is added to the CCS is equal to the difference in thermal energy between the water leaving the CCS and the water entering the CCS. This relationship is expressed by the following equation, HC = s cps Q(T4  T1 )                                        (4) where s and cps are the density and specific heat of the CCS water, Q is the flow rate of water through the CCS, T4 the temperature of the cooling water at the intake of the power plant (in Zone 4), and T1 is the temperature of the cooling water at the discharge from the power plant (in Zone 1). If the power-generating units add heat to the water at a rate HG , then between the intake and discharge end of the power-generating units the heat-balance equation is given by HG = s cps Q(T1  T4 )                                        (5)


Exhibit 17 23 Combining Equations 3, 4, and 5 requires that the heat rejection rate in the power-generating units, HG , is related to the net rate at which heat is added to the CCS, HC , by the relation 4 {
4 PumpingWaterfromtheL-31ECanalintotheCoolingCanals 34 4.1 PumpingPermitandProtocols................................. 34 4.2 QuantitativeEffects....................................... 37 4.3 ModelResults.......................................... 38 4.4 EnvironmentalEffects..................................... 39 4.4.1 EffectofIncreasedWater-SurfaceElevationsintheCCS............... 39 4.4.2 SuggestedPermitModi"cations............................ 43
                                                                                                                                                                                                                  }
HG =                                  [(1 )Rs + Eh + Rh + La + Lw + Gh ]i Ai                                                                                                                            (6) i=1 This equation can be used to estimate the heat-rejection rate, HG , of the power-generating units based on field measurements that are used to calculate the terms on the righthand side of Equation 6. In cases where daily time steps are used, estimated values of HG might fluctuate about a mean value and be difficult to discern. In such cases, the average heat-rejection rate, HG J , over a period of J time steps can be estimated using the relation 1
J HG J =            HG t                                        (7)
Jt j=1 where t is the duration of each time step. In accordance with Equation      7, a constant heat rejection rate can be recognized by plotting the cumulative estimated heat rejection rate, Jj=1 HG t, versus time, Jt, which would would result in a straight line of constant slope equal to HG J . This relationship was used in this study to identify periods of constant heat rejection rate of the power-generating units that utilize the CCS.
2.2.4 Model Results The heat-balance model was applied to each of the four zones within the CCS to determine the net heat flux into each zone, and the results from all zones were combined to determine the net heat flux into the entire CCS. The energy model was applied at daily time steps for the period of record 9/1/10 - 12/7/14. The thermal-energy dynamics within each of the CCS zones are similar, and the fluctuations of the heat-flux components in Zone 1 will be used to demonstrate the thermal-energy dynamics within each zone.
Zone 1 heat-flux components. The longwave radiation and shortwave solar energy fluxes as a function of time are shown in Figure 6(a), and the evaporation and rainfall heat fluxes as a function of time are shown in Figure 6(b). It is apparent that the shortwave and longwave energy fluxes vary seasonally, and that there Longwave atmospheric (La)                                                        Solar (Rs)                                              Rainfall (Rh) 40                                                                                                                      40 Heat "ux (MJ/m2 d) 20                                                                                                                      20                                                                                Evapora!on (Eh) 0                                                                                                                        0 20                              Longwave water (Lw)                                                                  20 40                                                                                                                    40 60                                                                                                                    60 9/1/10    1/1/11  5/1/11  9/1/11  1/1/12  5/1/12  9/1/12  1/1/13  5/1/13  9/1/13  1/1/14  5/1/14  9/1/14        9/1/10  1/1/11    5/1/11  9/1/11  1/1/12  5/1/12  9/1/12  1/1/13  5/1/13  9/1/13  1/1/14  5/1/14  9/1/14 (a) Longwave and solar energy                                                                                              (b) Rainfall and evapora!on energy Figure 6: Energy fluxes in Zone 1


Exhibit 17 24 is much more seasonal variation in the shortwave solar radiation than in the longwave radiation. The net longwave radiation has a cooling effect (i.e. net negative heat flux) which contributes to a net-radiation cooling of the CCS water at night when the solar radiation is effectively zero. It is apparent from Figure 6(b) that evaporation and rainfall generally have a cooling effect, with evaporation usually having the greater cooling effect and rainfall having a lesser cooling effect. The convective heat flux between the CCS and the adjacent groundwater, Gh , is not shown in Figure 6 because the magnitude of Gh is generally much smaller that the heat flux due to rainfall and therefore has a minimal impact on the heat balance within the CCS.
5 ConclusionsandRecommendations 43 Exhibit 17
Heat rejection rate of the power-generating units. To determine the thermal dynamics in the entire CCS, the component heat fluxes were determined for each zone within the CCS, and these heat fluxes were combined in accordance with Equation 6 to determine the thermal energy that is added to the CCS by the power plant (i.e., the heat-rejection rate). The cumulative heat-rejection from the power plant as a function of time for the entire CCS is shown in Figure 7. It is apparent from Figure 7 that there are two Cumula ve thermal energy (x 1011 MJ) 6.0 Measured/Normal ( = 0.1) 5.0                      Straight-line "t 10/1/13 4.0 6/1/13 3.0 Period 1 Period 2 2.0 1.0 0.0 4/29/11  8/27/11  12/25/11  4/23/12  8/21/12  12/19/12      4/18/13            8/16/13  12/14/13    4/13/14  8/11/14  12/07/14 9/1/10 12/30/10 Figure 7: Cumulative heat rejection rate from the power plant periods during which the heat rejection rate is approximately constant. The first period, shown as Period 1 in Figure 7, covers the time interval 9/1/10 - 2/1/13, and the second period (Period 2) covers the time interval 7/1/13 - 12/1/14. Notably, Period 1 includes the pre-uprate period before May 2013 and Period 2 includes the post-uprate period after May 2013. During Period 1, the average heat-rejection rate is estimated to be around 2800 MW, and during Period 2 the average heat-rejection rate is estimated to be around 5500 MW.
Although these estimated heat rejection rates are preliminary estimates and derived from an uncalibrated heat-balance model, the distinct difference in heat-rejection rates between the two periods is clear, and the numerical estimates of the heat-rejection rates during these two periods are reasonable given the capacities of the power-generating units serviced by the CCS and the energy efficiencies normally associated with both fossil-fuel and nuclear power plants. A logical inference from the results shown in Figure 7 is that the uprate in power-generating capacity of the two nuclear units (Units 3 and 4) has caused the total heat-rejection rate from the power plant to increase significantly. This finding is not inconsistent with the condition that the post-uprate generating capacity of the power plant served by the CCS is less than the pre-uprate generating


Exhibit 17 25 capacity (due to Unit 2 operating in synchronous generator mode). This is so because in the post-uprate generating capacity there is a significant shift from fossil-fuel generation to nuclear-power generation, and nuclear-power units are known to have a much higher heat-rejection rates to cooling water than fossil-fuel generating units, which release a significant portion of their waste heat in flue-gas emissions.
6
Effect of algae. It is assumed that the algae content of the CCS affects the heat balance in the CCS by increasing the amount of solar energy that is absorbed by the CCS. Consequently, the effect of algae in the CCS was investigated by reducing the albedo (i.e., reflectivity), , of the water surface from 0.1 to 0.0 starting on January 1, 2014. An albedo of 0.1 was used in the normal simulations presented in Figure 7 since this is the typical value of  that is associated with water surfaces at subtropical latitudes; this corresponds to 90% of the incident solar radiation being absorbed by the water in the CCS. Assuming that the effect of algae is to retain more solar heat, then taking  = 0 reflects the extreme case where the CCS with high concentrations of algae absorbs 100% of the incoming solar radiation. The effect of reducing from 0.1 to 0.0 on the estimated cumulative heat-rejection rate is shown in Figure 8. It is apparent that the Cumulave thermal energy (x 1011 MJ) 6.0 Normal ( = 0.1)
Algae saturated ( = 0.0) 5.0 4.0 10/1/13 3.0 2.0 4/18/13            8/16/13              4/13/14  8/11/14 12/14/13                      12/07/14 Figure 8: Estimated algae effect on estimated cumulative heat rejection rate from the power plant impact of the higher absorption rate of solar energy attributed to high algae concentrations is relatively small compared with the heat rejection rate of the power-generating units. In quantitative terms, the increased rate of heating of the CCS due to reduced reflection of solar energy is around 400 MW, compared with a normal heat rejection rate of around 5700 MW (in 2014). This indicates that the (maximum) rate of increased heating caused by algae is only around 7% of the normal heat-rejection rate, and hence there is a relatively small heating effect caused by algae in the CCS.
Relationship between increased net heat flux and temperature. An increased heat-rejection rate would be expected to increase the temperature in the CCS relative to the temperature of the overlying air. Repre-senting the temperature in the CCS as Ts , and the temperature of the overlying air as Ta , this temperature difference is Ts  Ta . The variation of Ts  Ta as function of time for each of the four CCS zones is shown


Exhibit 17 26 in Figure 9, where the average temperature difference during Period 1 and Period 2 are shown as horizon-tal lines. It is apparent from Figure 9 that the increase in the average heat-rejection rate from Period 1 to 25                25 Zone 1            Zone 2 20                20 15                15 Temperature difference, Ts - Ta (oC) 10                10 5                  5 0                  0
1 Background
                                        -5                -5 25                25 Zone 3            Zone 4 20                20 15                15 10                10 5                  5 0                  0
                                        -5    9/1/10 12/1/10 3/1/11 6/1/11 9/1/11
                                                          -5    9/1/10 12/1/10 3/1/11 6/1/11 9/1/11 12/1/11 3/1/12 6/1/12            12/1/11 3/1/12 6/1/12 9/1/12 12/1/12 3/1/13            9/1/12 12/1/12 3/1/13 6/1/13 9/1/13 12/1/13            6/1/13 9/1/13 12/1/13 3/1/14 6/1/14 9/1/14            3/1/14 6/1/14 9/1/14 12/1/14            12/1/14 Figure 9: Temperature differences between CCS and overlying air. Horizontal lines show intervals of con-stant heat-addition rates.
Period 2 corresponds to an increase in the average value of Ts  Ta . Representing the average value of Ts  Ta during Period 1 as T 1 and the average value of Ts  Ta during Period 2 as T 2 , these averaged values for each CCS zone are shown in Table 2, along with the corresponding standard deviations, S1 and S2 , respectively. These results show that in Zone 1, which accepts the cooling-water discharge, the average temperature difference between the CCS and the overlying air has increased from 9.6 C (18 F) to 13.1 C (23.6 F), which corresponds to an average temperature increase of 3.5 C (6.3 F). In Zone 4, which con-tains the cooling-water intake, the average temperature difference between the CCS and the overlying air has increased from 2.8 C (5.0 F) to 5.4 C (9.7 F), which corresponds to an average temperature increase of 2.6 C (4.7 F). These changes in average temperature can be contrasted with previous (pre-uprate) pre-dictions made by FPLs engineering consultants in 2008 where it was anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 1.4 C (2.5 F) in the discharged cooling water (to Zone 1) and an increase of 0.5 C (0.9 F) in the temperature of the intake water (from Zone 4). The standard deviations of the temperature fluctuations are similar across all zones, and have shown relatively modest decreases between the pre-uprate and post-uprate periods. Of particular interest, in Zone 1 the standard de-viation decreased from 3.8 C (6.8 F) to 3.3 C (5.9 F), and in Zone 4 the standard deviation decreased from 3.9 C (7.0 F) to 3.5 C (6.3 F).


Exhibit 17 27 Table 2: Temperature Statistics in CCS Period 1        Period 2 T 1    S1    T 2      S2    T 2  T 1 Zone    ( C)  ( C)  ( C)    ( C)  ( C)  ( F) 1      9.6    3.8    13.1      3.3    3.5      6.3 2      4.6    3.7    8.4      3.7    3.8      6.8 3      2.9    3.9    5.5      3.6    2.6      4.7 4      2.8    3.9    5.4      3.5    2.6      4.7 Thermal efficiency. The thermal efficiency, t , of the CCS is a measure of the ability of the CCS to cool the water down to the background air temperature. The thermal efficiency of the CCS was previously measured by Lyerly (1998) using the relation Ti  Ta t = 1                                                    (8)
This investigation is primarily focused on the operation of the cooling-canal system (CCS) located at the Turkey Point power-generating station in south Miami-Dade County, Florida. The issues of concern relate primarilytotheincreasedtemperaturesandsalinitiesthathaverecentlybeenmeasuredintheCCS,theenvi-ronmentalimpactsoftheseincreasedlevelsonthequalityofgroundwaterintheBiscayneAquifer,theneed for additional engineered systems to supply supplemental cooling water to the CCS, and the environmental impactsofpermittedpumpingofupto100mgdofwaterfromtheL-31ECanaltotheCCSbetweenJune1 andNovember30.
Td  Ta where Td and Ti are the temperatures of the cooling water at the discharge and intake ends of the power plant, respectively, and Ta is the temperature of the ambient air above the CCS. The thermal efficiency of the CCS can be estimated using Equation 8 by replacing Td  Ta by the average value of Ts  Ta in Zone 1, and replacing Ti  Ta by the average value of Ts  Ta in Zone 4. Using the averaged temperature differences given in Table 2 in Equation 8 gives:
2.8                                    5.4 Period 1: t = 1        = 0.71,      Period 2: t = 1        = 0.59 9.6                                    13.1 These results indicate that the thermal efficiency of the CCS in Period 1 is around 70% and the thermal efficiency of the CCS in Period 2 is around 60%. Hence, the thermal efficiency of the CCS has apparently decreased between Period 1 and Period 2. The reason for this decrease in thermal efficiency is not readily apparent and could be due to a variety of factors, including increased thermal loading and increase algae concentrations in the CCS. It should be noted that the thermal efficiency of 86% reported by Lyerly (1998) is not directly comparable to the values calculated here, since the additional cooling between the discharge location and the Zone 1 temperature measurement station, as well as the additional cooling between the intake location and the Zone 4 temperature measurement location are not taken into account in the present analysis.
2.2.5 Conclusions The results derived from the heat-balance model indicate that the rate of heat addition to the CCS has in-creased significantly during the period of record, and that the increased heat-addition rate is manifested in an increase in the average temperature in the CCS relative to the temperature of the overlying air. It appears that the most likely cause for the increased heat-addition rate is an increased heat-rejection rate from the power-generating units. Notably, the increased heat-addition rate began shortly after the beginning of the post-uprate period. As a result of the increased heat addition to the CCS, the average temperature in the intake zone (Zone 4) has increased by approximately 2.6 C (4.7 F). Interestingly, this measured increase in


Exhibit 17 28 average temperature is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2 C (4.0 F)¶ approved by the Nuclear Regulatory Commission in 2014. There-fore, the increased maximum allowable operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, and might have slightly increased the probability of exceeding the threshold temperature. This serves as a cautionary note regarding further increases in power generation beyond 2014 levels without providing a supplementary system to cool the water in the CCS. Others have cited increased algae concentrations in the CCS as being as a possible reason for elevated temperatures of the water in the CCS. However, a sensitivity analysis indicates that changes in the algae-influenced solar reflectivity of the CCS within a realistic range are unlikely to have been of sufficient magnitude to cause the observed changes in temperature, nor stimulate the sudden change in heat-addition rate that was observed almost immediately after the beginning of the post-uprate period. There are indications that the thermal efficiency of the CCS has decreased significantly between the pre-uprate and post-uprate periods. Further investigation is recommended to confirm this finding and to identify the factor(s) causing the reduced ther-mal efficiency.
Environmental concerns. Most of the environmental concerns regarding the operation of the cooling-canal system (CCS) at Turkey Point relate to: (1) the sustainability of the system in maintaining adequate temperatures to cool the power-generating units, (2) the impact that current and projected future salinities in the CCS have on the quality of groundwater in the surrounding Biscayne Aquifer, and (3) the need for new supplementary sources of water and/or revised operational protocols to control the temperatures and salinitiesintheCCS.Speci"cissuesofconcernareasfollows:
Limitations of the heat-balance model. The heat-balance model developed for this study is based on the best estimates of all of the heat-balance components that influence the temperature in the CCS. However, the heat-balance model has not been calibrated due to lack of available data for calibration. Data required to calibrate the heat-balance model would include synoptic measurements of the flow rate and temperature differences between the intake and discharge structures of the power-generating units, and synoptic tem-peratures and flow rates at the inflow and outflow faces of each CCS zone. Calibration of the heat-balance model would not necessarily change the key inferences that have been drawn from the uncalibrated model, namely that there has been a significant increase in the heat-rejection rate from the power-generating units during the post-uprate period, and that increased algae concentrations and increased ambient temperatures are not the most likely causes of elevated temperatures in the CCS. Further development of a calibrated heat-balance model is warranted to confirm the conclusions that have been drawn.
* Increased temperatures in the CCS limit the effectiveness of the CCS as a cooling-water source ser-vicing four power-generating units. When the intake temperature in the CCS exceeds a regulatory limiting value of 104F, either power generation must be curtailed or supplementary cooling water must be provided to the CCS to reduce the temperature and hence keep the generating units in op-eration; the sustainability of a supplementary system to cool the water in the CCS has not yet been established.
3    Salinity Variations in the Cooling Canals Salinity is defined as the mass of dissolved salts per unit mass of solution, and is usually reported directly in units of either parts per thousand () or as a dimensionless number on the practical salinity scale 1978 (PSS-78). Salinities are sometimes expressed indirectly in terms of chlorinity (mg/L chloride) or conductance (mS/cm). In this report, salinities are expressed in units of parts per thousand (), which gives salinities approximately equal in magnitude to salinities expressed in PSS-78. As reference points, average seawater at 25 C has a salinity of 35, a chlorinity of 19.84 g/L, and a specific conductance of 54.7 mS/cm. Hypersaline water is typically defined as water with a salinity greater than 40 or a specific conductance greater than 61.5 mS/cm, and brine is typically defined as water with a salinity greater than 50. These hypersalinity and brine thresholds are routinely exceeded in the CCS, and therefore water within the CCS can be properly classified either as being hypersaline or as brine.
* Increased salinity in the CCS likely contributes to increased saltwater intrusion within the Biscayne Aquifer, thereby deteriorating the groundwater quality underlying inland areas. The current salinity-control system, sometimes called the interceptor-ditch system, has not been effective in controlling the inland migration of saline water from the CCS, thereby signaling the need for revised operating strategiestomanagesalinityintrusionresultingfromCCSoperation.
    ¶ From 37.8 C to 40 C (100 F to 104 F)
* Theeffectivenessofthepermittedprotocolforpumping100mgdfromtheL-31ECanalintotheCCS to reduce temperatures in the CCS, and the effect of this pumping operation on saltwater intrusion in theBiscayneAquiferandwaterqualitywithintheL-31ECanalareissuesthatareyettoberesolved.


Exhibit 17 29 3.1              Results from Previous Studies There has been a continuous upward trend in salinity since the CCS began operation in August 1973, and this trend is clearly apparent in Figure 10, which shows the maximum reported salinities in the CCS since the initial NPDES report was submitted in 1973. The long-term trend of increasing salinity shown in Figure 10 100 NPDES Permit TPSWCCS-1B (Automated) 80          TPSWCCS-1B (Manual)
This report summarizes what is currently known about the CCS, summarizes key "ndings from previous related investigations, regulatory reports and reviews, provides new analyses, and gives suggested answers andpathwaysforwardtoresolveseveralissuesrelatedtotheabove-listedconcerns.
Salinity ()
Trend line 60 40 20 Aug 1973      May 1976      Feb 1979  Nov 1981  Aug 1984  May 1987  Jan 1990  Oct 1992  Jul 1995  Apr 1998  Jan 2001  Oct 2003  Jul 2006  Mar 2009  Dec 2011  Sep 2014 Figure 10: Maximum observed salinities in the CCS since initial operation can be approximated as being linear (as shown by the linear trend line) with a salinity increase of around 5 per 10 years. It is also apparent from Figure 10 that the rate of increase in salinity might have accelerated since 2013. The salinity in the CCS when it was first put into operation was around 26.5, with the contemporaneous salinity in Biscayne Bay being around 33 (Lyerly, 1973). The average CCS salinity in 1998 was reported to be in the range of 38 - 50 (Lyerly, 1998), and in May 2014, the salinity in the CCS was reported to be as high as 95.
Salinity-control processes. The key processes affecting the salinity in the CCS are: rainfall, evaporation, and groundwater exchange between the CCS and the surrounding aquifer. Average annual rainfall at Turkey Point is approximately 60 inches, and the natural annual evaporation at Turkey Point is approximately equal to the average annual rainfall. Actual evaporation of water from the CCS exceeds natural evaporation due to the elevated temperatures in the CCS. The steady increase in salinity since operation of cooling canals began in the early 1970s (as shown in Figure 10) has been most commonly attributed to evaporation excess over rainfall.
3.1.1 Historical Chloride Levels Chloride concentrations (i.e., chlorinities) in the CCS between June 2010 and June 2012 were in the range of 26 - 46 g/L with an average chlorinity of 33.9 g/L. The average chlorinity in Biscayne Bay during the same period was 18.9 g/L (Ecology and Environment, Inc., 2012). There is little difference (less than 10%) in chloride concentration between samples collected near the surface or near the bottom at any given sampling location within the CCS canals. Chloride concentrations in the CCS during the post-uprate period were observed in range of 27.0 - 49.8 g/L, with the highest values observed in March 2014 and the lowest values in June 2013 (Ecology and Environment, Inc., 2014).


Exhibit 17 30 3.1.2 Historical Specific Conductance Levels Specific conductances in the CCS between June 2010 and June 2012 were in the range of 70 - 90 mS/cm.
1.1 TurkeyPointPowerStation The Turkey Point Power Station currently consists of "ve power-generating units: two 404-MW oil/natural gas-"redgeneratingunits(Units1and2),two728-MWnuclear-poweredunits(Units3and4),andanomi-nal1150-MWnaturalgas-"redcombined-cycleunit(Unit5). In2002,theNuclearRegulatoryCommission (NRC) extended the operating licenses for both nuclear reactors from forty years to sixty years, extending licensed operation to the year 2033. In June of 2009 the Florida Department of Environmental Protection (FDEP)issuedcerti"cationfortheincreaseinpower-generatingcapacity(commonlycalledanuprate)of Exhibit 17
Specific conductance in the CCS has been rising since the beginning of the dry season in 2014 and reached over 120 mS/cm in May 2014. The average post-uprate specific conductance for all CCS stations was reported as 92.6 mS/cm, and this average value was over 15 mS/cm higher than the average value reported in the pre-uprate period.
3.2      Salinity-Balance Model of CCS The salinity-balance model of the CCS that is currently being used to simulate salinity variations in the CCS was developed by engineering consultants for FPL. The salinity-balance model uses a finite-control-volume approach in which the control volume is defined to include the canals of the CCS and the adjacent interceptor ditch (ID). The salinity-balance model is closely related to a companion water-balance model, with both models having been developed by the same contractor and described by Ecology and Environment, Inc. (2012). For purposes of the current analyses, this previously developed model will be accepted as valid and the relevant components of the model formulation are described in the following section.
3.2.1 Salinity-Balance Model Formulation Component salinity fluxes into and out of the defined control volume are determined by multiplying the water (volume) flux by the corresponding salinity. The components of the water balance model are the lateral and vertical seepage into the CCS, blowdown water (i.e., additional water pumped from other units to the CCS), rainfall (including runoff from earth berms between canals), and evaporation. The key features of the salinity model are as follows:
* The base of the control volume is assumed to be the bottom of the ID and the cooling canals, whose elevation ranges from approximately 3 ft feet NAVDll to approximately 30 ft NAVD. The elevation of bottom of the ID is approximately 20 ft NAVD. Sloping sidewalls of the canals in the CCS are taken into account by expressing the water-surface area as a function of the water-surface elevation(s) in the CCS.
* Lateral seepage of water and salt between the L-31E Canal and the control volume is calculated directly from the product of the calibrated hydraulic conductivity and the difference in water-surface elevations between the L-31E Canal and the ID.
* Lateral seepage of water and salt between Biscayne Bay and the control volume is calculated directly from the product of the calibrated hydraulic conductivity and the difference in water-surface elevations between the CCS and Biscayne Bay.
* Vertical seepage of water and salt through the bottom of the control volume is calculated directly from the product of the calibrated hydraulic conductivity and the difference in the water-surface elevations in the CCS and the measured and estimated piezometric heads beneath the CCS.
* Evaporation is estimated using Equation 2, which uses meteorological data collected from meteoro-logical stations in and immediately to the north and south of the CCS.
ll NAVD refers to the NAVD 88 datum.


Exhibit 17 31
7
* Rainfall is estimated using Next Generation Weather Radar (NEXRAD) precipitation data provided by the SFWMD. Runoff into the control volume from earth berms between canals is used as a calibration parameter and is initially assumed to be 50% of the rainfall that falls on the berms.
 
* Added water from Units 3 and 4 are assumed to be freshwater (non-saline); Unit 5 blowdown salin-ities are adjusted to between 20% and 80% of seawater (35), with the exact percentage used as a calibration parameter.
Units 3 and 4 to provide an additional 250MW of power. Unit 3 has been operating at its uprated power-generation capacity since Nov 2012, and Unit 4 has been operated at its uprated power-generation capacity since May 2013. In planning for the Unit 3 and Unit 4 uprates, it was anticipated that the uprate would increase the temperature of the cooling water discharged to the CCS by 2.5F (1.4C), from 106.1F to 108.6F (41.2C to 42.6C) (FPL 2011), and that the increased temperature in the CCS might result in in-creased evaporation and increased salinity. The CCS provides cooling water for Units 1 to 4, with cooling of Unit5 accomplished by mechanical-draft cooling towers that use make-up water drawn from the Upper Floridan Aquifer. Blowdownwaterfrom Unit5 is dischargedinto the CCS. Since the uprate of Units 3 and 4 went into effect, Unit 2 has not been operational. In 2014, the Florida legislature approved construction of two additional nuclear reactors at Turkey Point (Units 6 and 7), with each additional unit having an ap-proximate electrical output of 1100MW; approval of the additional units by the NRC is currently pending.
* The ID control system is simulated to operate primarily between the months of January and June; with pumping rates as high as 50 mgd and averaging 4.5 mgd over the calibration period.
The two additional nuclear reactors will not use the CCS for cooling. Presently, with an estimated total power-station capacity of approximately 3550MW, the Turkey Point power station is the second largest powerstationinFlorida,intermsofgeneratingcapacity,andisthesixthlargestpowerstationintheUnited States(NRC,2012).
* The water-budget model is calibrated first by minimizing the errors between the simulated and ob-served storage in the control volume. Parameters adjusted during calibration of the water-budget model included the hydraulic conductivities in the aquifer adjacent to and beneath the CCS, an evap-oration factor that adjusts the coefficients in the wind function, the amount of runoff that enters the control volume as percentage of precipitation, and the amount of Unit 5 cooling-tower water that is lost to evaporation before entering the CCS. The salinity model uses measured salinities in and around the CCS.
 
Calibrated values of the horizontal hydraulic conductivities in the aquifer surrounding the control volume have been found to be in the range of 500 - 950 ft/d, and calibrated values of the vertical hydraulic con-ductivities beneath the control volume have been found to be in the range of 0.1 - 4 ft/d. Vertical hydraulic conductivities beneath the northern discharge canals and beneath the return canals, where it is assumed deeper canals intersect highly permeable material underlying the muck and Miami Limestone Formation, were calibrated to have (higher) vertical hydraulic conductivities of 3.8 ft/d and 4 ft/d, respectively. Lower vertical hydraulic conductivities of 0.1 ft/d were calibrated for the mid- and southern portions of the dis-charge canals, as well as the southern portion of the return canals. Calibration of the salinity model was done entirely by the FPL contractor.
1.2 Geohydrology The Turkey Point power station and associated cooling-canal system (CCS) are underlain by the Biscayne Aquifer. In the vicinity of Turkey Point, the Biscayne Aquifer extends from land surface to a depth of ap-proximately 106ft below sea level (BSL), with the thickness of the aquifer decreasing towards the west.
3.2.2 Previous Model Results The model was run to simulate salinity variations both before the uprate (i.e., before November 2012) and after the uprate (i.e., after May 2013). The results of these model simulations are useful in understanding the salinity dynamics in the CCS and are described below.
Geologic formations within the Biscayne Aquifer include, from the ground surface downward, the Miami Limestone Formation, Key Largo/Fort Thompson Formations, and upper portions of the Tamiami Forma-tion. The less-permeable units of the Tamiami Formation, and the deeper Hawthorn Group, form the con-
Pre-uprate model results. The salinity model was calibrated for a 22-month pre-uprate period and the results showed an average volume outflow rate from the CCS of 0.62 mgd, with monthly-averaged outflow rates ranging from 46.6 mgd (October 2010) to +52.1 mgd (September 2010) (Ecology and Environment, Inc., 2012). Net flow through the bottom of the CCS was generally outward between the dry-season months of September through February, and inward during the wet-season months. Average inflow from precipita-tion during the wet season was more than twice that for the dry season. It was reported that vertical flows into and out of the control volume were substantially larger than lateral flows.
"ning unit between the Biscayne Aquifer and the Upper Floridan aquifer. The top of the con"ning unit is characterized by the transition between highly permeable beds of the Fort Thompson Formation and the lower-permeabilitysiltysandsoftheTamiamiFormation. ThethicknessoftheMiamiLimestoneFormation is in the range of 8-23ft, and the thickness of the Fort Thompson Formation is in the range of 46-95ft.
Post-uprate model results. A second round of salinity-model results was reported for the post-uprate period of June 2013 - May 2014 (Ecology and Environment, Inc., 2014). The results showed an average outflow rate of 3.26 mgd, with monthly-averaged outflow rates ranging from 31.1 mgd (June 2013) to
The regional groundwater "ow direction is, on average, from the northwest to southeast (Fish and Stewart 1991), although the predominant "ow direction at the coast can vary signi"cantly between the wet and dry seasons. The water-table gradient is typically towards the coast during the wet season (May-October),
but can be directed inland during the dry season (October-April). The possibility of the occurrence of an inland water-table gradient is the primary reason for the so-called interceptor-ditch system that is used ostensibly to control the inland migration of saline water originating from the CCS. Water-table elevations atTurkeyPointaretypicallyaround1ftNGVD,andthemagnitudeoftheaverageregionalwater-tablegra-dient is typically in the range of 0.004%-0.005%. Notably, with such small water-table gradients, small errors in measured water-table elevations can signi"cantly impact the accuracy of the estimated gradients.
Vertical piezometric-head gradients at the Turkey Point site (away from the CCS) are typically negligible, with piezometric-head differentials between shallow, intermediate, and deep zones reportedly being within hundredthsofafoot.
 
Groundwater classi"cation. Groundwater at the Turkey Point site was originally classi"ed by FDEP as as G-II, which is the classi"cation for groundwater that is of possible potable use and has a total dissolved solids content of less than 10,000mg/L. In September 1983, at the request of FPL, the groundwater at the Turkey Point site was reclassi"ed by FDEP as G-III, which is the classi"cation for groundwater that Exhibit 17
 
8
 
has a total dissolved solids content of 10,000mg/L or greater, or has a total dissolved solids of 3,000-10,000mg/L and has no reasonable potential as a future source of drinking water. The G-III classi"cation currentlyremainsineffect.
 
1.3 TheCooling-CanalSystem History and regulation. Construction of the cooling-canal system (CCS) was approved by the Dade CountyBoardofCountyCommissionersinNovember1971,andbecameoperationalinFebruary1973. At thetimeofitsinitialoperation,theCCSwasapproximatelyhalf-waycompletedcomparedwiththepresent system. TheCCSissometimesreferredtoasanIndustrialWastewaterFacility(IWW)sincethecirculating water system, which discharges saline water to the surrounding aquifer, is regulated under the federal Na-tional Pollutant Discharge Elimination System (NPDES) and an Industrial Wastewater (IW) permit issued toFPLbytheFloridaDepartmentofEnvironmentalProtection.
 
Currentcanalsystem. Initspresentstate,theCCSisapproximatelytwomileswide(east-west)and"ve miles long (north-south), covers an area of approximately 5900acres, and has approximately 4370acres of water surface. The CCS consists of 32 canals "owing south from the discharge location in the north, and 7 return canals "owing north to the intake location. Because the south-"owing canals are located in the western section of the CCS and the north-"owing canals are located in the eastern section of the CCS, the system is sometimes referred to as having 32 western canals and 7 eastern canals. The south-"owing (western) canals are each approximately 4ft deep, 200ft wide, and spaced approximately 90ft apart; these canals range in length from 2-5miles. The 4ft depth of the canals (from ground surface) was originally chosen so as to not penetrate the less-permeable sur"cial Miami Oolite Formation that extends to about 4ftbelowgrade,therebyminimizinggroundwaterexchangebetweentheCCSandtheunderlyingBiscayne Aquifer. The bottom of the canals are below the lowest water-table elevation expected in the Biscayne Aquifer at Turkey Point, and therefore the canals always contain water that is directly connected to the adjacentgroundwater. Coolingwaterleavesthefourgeneratingunits(Units1-4),"owsintoLakeWarren, and then into the 20-ft deep 100-ft wide feeder canal that connects to the 32 south-"owing cooling canals.
Four shallow cross canals spaced 1-mile apart run east-west across the 32 south-"owing cooling canals.
These cross canals contain "ow-control structures that distribute water "ow evenly to the canals so that each cooling canal carries a "ow that is proportional to its surface area in order to optimize heat exchange with the atmosphere. At the southern end of the CCS is a collector canal that is approximately 20ft deep and 200ft wide. Water returns to the power-generating units from the southern collector canal via 6 north-
"owing canals, the largest of which is the Card Sound Canal which is 200ft wide and 20ft deep. The average length of the circulation path between the discharge and intake locations is 13.4 miles. The 32 south-"owing cooling canals are numbered from 1 to 32, from east to west, hence, cooling-canal number 32 is the westernmost canal in the CCS. Endangered American crocodiles (Crocodylus acutus) inhabit the cooling canals. During nesting season, more than 40 adult crocodiles have been observed in the canals, although there have been some reports that the crocodile population in the CCS is declining possibly due directlyorindirectlytotheincreasedsalinitiesintheCCS.
 
Operational characteristics. The canals in the CCS were designed to operate at a total "ow rate of 4250ft3/s (2750mgd) when all four generating units (Units 1-4) supported by the CCS are in full oper-ation. Small wastewater (blowdown) "ows from Unit5 are also discharged into the CCS. Typically, the "ow rate through the CCS varies signi"cantly with the electric load demand on the generating units, and is Exhibit 17
 
9
 
usually in the range of 2700-4250ft3/s (1750-2750mgd) on any given day, with a typical "ow depth of around 2.8ft. Thermal energy is dissipated in CCS as water moves from north to south, with the primary heat-exchangeprocessesbeingevaporation,solarradiation,andbothemittedandabsorbedlongwaveradia-tion. Maximumtemperaturesnearthedischargelocationofthepower-generatingunitsaretypicallyaround 108F (42C), and maximum temperatures near intake to the power-generating units are typically around 93F(34C);thedifferencebetweenthesetypicalmaximais15F(8C),whichgivesameasureofthecool-ing effect of the CCS. The (regulated) maximum allowable temperature at the intake location in the CCS is 104F (40C). The "ow in the CCS is driven by 12 condenser-circulating pumps and auxiliary cooling pumps. The CCS typically contains approximately 7  10 8 ft3 of water, and the average velocity is around 0.25ft/sineachcanal. Approximatelytwodays(44-48h)arerequiredforwaterintheCCStotravelfrom the discharge location to the intake location. Within the CCS, the "ow is maintained by a head differential between the discharge and intake locations, with the water-surface elevation being highest at the discharge location and lowest at the intake location. The water level at the discharge location is typically about 3ft higher than the water level at the intake location. Typical water surface elevations in the CCS are 2.04ft NGVD at the discharge location, 0.76ft NGVD at the south end, and 0:77 ft NGVD at the intake loca-tion. Thewater-surfaceelevationatsouthendoftheCCSisusuallyclosesttothewater-surfaceelevationin Biscayne Bay. The water-surface elevation in the CCS is typically higher than the site-average water-table elevation in the Biscayne Aquifer at the discharge (north) end of the system, approximately equal to the water-table elevation at the south end of the system, and below the water table at the intake (north) end of thesystem. Consequently,watergenerally"owsoutoftheCCSintotheaquifernearthedischargelocation of the CCS and water generally "ows into the CCS from the aquifer near the intake location of the CCS, thereisless"owinteractionbetweentheCCSandtheaquiferatthesouthernendofthesystem. Duringvery heavy rains, there can be a net in"ow to the CCS from the surrounding aquifer. The CCS is approximately nontidal, and water in the CCS is typically warmer than the air temperature. The effectiveness of the CCS asacoolingsystemdecreasesasthetemperatureintheCCSincreases.
 
1.4 AlgaeintheCCS A signi"cant algae bloom occurred in the CCS during 2014 and algae in now perceived to be a problem in theCCS.Priorto2013,onlylimitedandshort-termalgaebloomshadoccurredintheCCS,typicallyduring the early summer months. In fact, algae blooms were of such limited concern that routine monitoring for algae was not commonly done prior to 2014. In the summer of 2014, large-scale application of a CuSO4-basedalgaecidewasusedtoreducethealgaeconcentrationsintheCCS.Theappliedalgaecidewasreported asbeingineffectiveinreducingthealgaeconcentrations,servingonlytostabilizetheexistingconcentrations (SFWMD,2015).
 
Factors affecting algae concentrations. High concentrations of algae have been observed in the CCS withcorrespondinglyhighconcentrationsofnutrientsbeingmeasured. Thehistoricalaveragealgaeconcen-trationintheCCSisreportedtobe50cell/L,however,inthesummerof2014algaeconcentrationsashigh as 1600cell/L were reported (SFWMD, 2015). The addition of nutrients from the power-generating units intotheCCSisassumedtobenegligible,withnutrientslikelyoriginatingfromallochthonoussources. Total nitrogen (TN) concentrations in the CCS have been reported in the range of 1.7-5.3mg/L (Ecology and Environment,Inc.,2012). ThehighestreportedTNconcentrationsintheCCSweremeasuredatallstations in March 2012, which coincided with higher turbidities and pH in the CCS. The majority of the nitrogen
 
AlgaeconcentrationsarenormallygiveninChla /L,sotheseunitsareunusual.
Exhibit 17
 
10
 
in the CCS appears to be in organic form (typically 80%-90%). Total phosphorus (TP) concentrations in the CCS have been reported in the range of 4-73 g/L, with an overall average concentration of 36 g/L.
NumerousmeasurementsofTNandTPhavebeenreportedbetween7/2010and3/2015(EcologyandEnvi-ronment,Inc.,2010;2011a;2011b;2012a;2012b;2012c;2013a;2013b;2014a;2014b;2015),andsynoptic measurements within this time period yield TN/TP values in the range of 48-2015 with a median value of 142. Since the measured TN/TP values generally exceed the Red"eld ratio of 16, it can be inferred that TP isthecontrollingnutrientforalgaegrowthintheCCS.TheexistenceofTPcontrolofalgaegrowthinsaline systemsiscommonlyattributedtothepresenceofnitrogen-"xingplanktoniccyanobacteriawhichmakeup any short-term nitrogen de"cits (Howarth and Marino, 2006). It has been reported that the cyanobacteria Aphanothece sp. are the predominant algae species in the CCS; these species are nitrogen-"xing and thrive under hypersaline conditions. In addition to nutrients, both temperature and salinity are known to affect the growth of algae in water bodies. For given nutrient levels, increasing temperatures usually contribute to increased algae concentrations, and increasing salinities usually contribute to decreased algae concen-trations (Hakanson and Eklund, 2010). However, for the algae species commonly found within the CCS, algae concentrations have been reported to increase with increasing salinity (SFWMD, 2015). Algae con-centrations are usually expressed in terms of the mass of chlorophyll-a per liter. Synoptic measurements of chlorophyll-a (Chla ) concentration, salinity (S ), temperature (T ), and total phosphorus (TP) concentra-tion at locations near the discharge and intake locations in the CCS between May 31, 2015 and November 13, 2015 are plotted in Figure 1. These synoptic measurements collectively show the algae concentration
 
Figure1: Chlorophyll-a levelsintheCCSasafunctionoftemperature,salinity,andtotalphosphorus
 
(Chla ) decreasing with increasing salinity (S ), decreasing with increasing temperature (T ), and decreasing Exhibit 17
 
11
 
with increasing nutrient concentration (TP). All of these trends are contrary to the natural relationships be-tween Chla,S,T, and TP and are either anomalous or indicate the effect of an algaecide. Assuming that a CuSO4-based algaecide was applied during the period of measurements, the effectiveness of the algaecide can be seen by plotting the relationship between Chla and sulfate (SO4) concentrations, and this relation-ship is shown in Figure2. It is apparent from Figure2 that algae concentrations decrease signi"cantly with
 
Figure2: Chlorophyll-a levelsintheCCSsulfateconcentrations
 
increasingconcentrationsofalgaecide(asmeasuredbysulfateconcentration),indicatingthatadditionofan algaecideisaneffectivemeansofreducingalgaeconcentrationsintheCCS.However,itshouldalsobekept inmindthatChla reductionscausedbyanalgaecidearenecessarilyonlytemporary,sincethenaturalfactors causinghighlevelsofChla (i.e.,S,T,andTP)remainatelevatedlevelswithintheCCS.Sincethesystemis autotrophic, reduction of autochthonous TP levels should be targeted to ultimately reduce both algae levels andtheneedforrepeatedapplicationofalgaecide(s)intheCCS.
 
Impact of increased algae concentrations. It has been asserted (SFWMD, 2015) that increased algae concentrations and turbidities associated with algae blooms cause more solar energy to be absorbed in the CCS, and reduces the ability of the CCS to dissipate thermal energy. The primary mechanisms by which the CCS dissipates thermal energy are by evaporation and the emission of longwave radiation. A conventional assumption made by engineers and scientists is that the evaporation rate from a water body is unaffected by the concentration of algae in the water body. There is no scienti"c evidence documented in any published studies showing that the rate of evaporation from a water body is reduced by high algae concentrations. Further, there are no published studies showing that the emission of longwave radiation fromawaterbodyisparticularlysensitivetotheconcentrationofalgaeinthewater. Asaconsequence,the primary effect of increased algae concentrations in the CCS can be assumed to be increased absorption of solar radiation, which would increase the heating of the water and elevate the temperature of the water in theCCS.ThequantitativeeffectofincreasedsolarheatingoftheCCSduetoincreasedalgaeconcentrations isparameterizedbyareducedalbedoofthewatersurface, andtherelationshipbetweenthereducedalbedo and the corresponding increased temperature was investigated in this study using a heat-balance model described subsequently in Section 2.2 of this report. It should be noted that the trapping of solar energy due to increased algae concentrations would be moderated by the resulting increased evaporation which wouldcauseincreasedcoolingduetotheextractionofthelatentheatofvaporization.
Exhibit 17
 
12
 
1.5 SaltwaterIntrusion TheinlandextentofsaltwaterintrusionintheBiscayneAquiferisde"nedbythelocationofthe1000mg/L isochlor. As a reference concentration, the South Florida Water Management District (SFWMD) de"nes seawater as having a chlorinity (i.e., chloride concentration) greater than 19,000mg/L, and saline water as having a chlorinity greater than 250mg/L. Surface waters with chlorinities greater than 1500mg/L are classi"ed as marine waters, and surface waters with chlorinities less than 1500mg/L are classi"ed as fresh waters (F.A.C. 62-302.200). The landward extent of the saltwater interface (i.e., the 1000mg/L isochlor) varies naturally in response to a variety of factors, such as seasonal variations groundwater recharge and variations in rates at which groundwater is pumped from the aquifer. For example, prolonged droughts or excessivewaterusageinlandthatreducewater-tableelevationscancauseincreasedsalinityintrusion. Prior to the construction of the CCS, the groundwater underlying the Turkey Point site was naturally saline due to the proximity of the site to the coast. In fact, had the groundwater not been saline, construction of the cooling-canalsystematTurkeyPointwouldnothavebeenpermitted. Sincethewater-tablegradienttowards thecoastatTurkeyPointistypicallyverylow,andwiththelocationofthesaltwaterinterfacebeingpartially controlledbythosegradients,evenslightreductionsofthefreshwaterpiezometric-headgradientcancause substantiallandwardmovementofthesaltwaterinterface. Theoccurrenceoflandwardgradientsduringthe dryseasonpromotesinlandmovementofsalinegroundwater.
 
CCSimpactonsaltwaterintrusion. IthasalwaysbeenrecognizedthatconstructionoftheCCSwithout any mitigating salinity-control systems would cause the saltwater interface to move further inland. This expectation was based on the assertion that construction of a CCS containing saline water one mile inland from the coast is tantamount to moving the coast one mile inland, and also moving the associated saltwater wedge around one mile inland. Since water in the CCS has a higher salinity than seawater, and is therefore denserthatthewaterinBiscayneBay,theeffectoftheCCSisactuallygreaterthanmovingthecoastonemile inland. Tocompoundthiseffect,theengineeringconsultantsthatoriginallyanalyzedtheperformanceofthe CCSalsoassertedthatifthewaterlevelintheCCSweretobeincreasedby0.50ftabovethepreconstruction water-tableelevation,thenthetoeofsaltwaterwaterwedgeatthebaseoftheBiscayneAquifermightmove approximately7.5milesfurtherinlandduringthedryseasonascomparedtoitsoriginallocationduringthe dry season. The engineering consultants also asserted that in the wet season, an elevated water level of 0.50ftintheCCSmightmovethetoeofthesaltwaterwedgeapproximately1milefurtherinlandcompared to its original location during the wet season. Based partially on these expectations, the salinity-control system that is currently in place was designed to control the westward migration of saltwater originating in the CCS. This control system involves pumping water from a so-called interceptor ditch into the CCS in order to create a seaward hydraulic gradient between the L-31E Canal and the interceptor ditch, where the L-31E Canal is located to the west of the interceptor ditch. The protocol for operating this salinity-control systemandtheeffectivenessofthesystemarediscussedinSection1.6ofthisreport.
 
Tracing the movement of CCS water in the Biscayne Aquifer. Tritium has been selected by the cog-nizant regulatory agencies (SFWMD and DERM) to trace the movement of CCS water in the Biscayne Aquifer. Historicaldatafrom1974to1975showedCCStritiumconcentrationsintheCCStobeintherange of1556-4846pCi/L,andreportssubmittedbyFPLforthemonitoringperiodfromJune2010throughDe-cember2011showedCCStritiumconcentrationsintherangeof1260-14,280pCi/L.Naturalgroundwater at the base of the Biscayne Aquifer would be expected to have relatively low concentrations of tritium. A threshold concentration of 20pCi/L has been used as a baseline to infer the presence of groundwater orig-Exhibit 17
 
13
 
inating from the CCS. Groundwater with concentrations below 20 pCi/L are presumed not to be affected by the CCS. FPL does not concur with the selection of 20 pCi/L as a threshold or background tritium con-centration for surface water, pore water, or shallow groundwater. The basis of FPLs contention regarding the20pCi/Lthresholdisthatmultiplefactorssuchasatmosphericdeposition,vaporexchange,anderrorsin laboratory analysis can in"uence reported tritium levels. The FPL assertion is reasonable and is supported bymeasureddatathatindicateatmosphericandvaporexchangeeffectsontritiumconcentrationscanbepar-ticularly signi"cant in surface water and shallow groundwater, with signi"cance decreasing with distance from the CCS. However, at depth, the CCS appears to be the primary source of tritium, and using tritium as a tracer in the lower elevations of the Biscayne Aquifer is reasonable. Reported measurements show groundwater tritium concentrations in excess of 3000pCi/L near the CCS, with concentrations decreasing withdistancefromtheCCS,andfoundatconcentrationsofhundredsofpCi/LthreemileswestoftheCCS at depth. The approximate limit of the 20 pCi/L concentration contour is 3.8-4.7mi west of the CCS and 2.1mieastoftheCCS.Basedonthestrengthofthesedataandsupportinganalyses,itisreasonabletocon-clude that operation of the CCS has impacted the salinity of the Biscayne Aquifer within the limits of the 20pCi/Lcontour.
 
1.6 L-31ECanalandInterceptorDitch L-31ECanal LeveeL-31Eanditsadjacent20-ftdeepborrowcanaltothewestoftheleveewereprimarily constructedasabarriertopreventsalinityintrusiontolocationswestofthecanal. TheL-31ECanalcollects water from other drainage canals in the area that include Military Canal, North Canal, Florida City Canal, North Model Land Canal (C-106), and South Model Land Canal (C-107). The L-31E Canal discharges into Biscayne Bay through structures S-20 and S-20F in the vicinity of Turkey Point. The L-31E Canal was constructed in the late 1960s by the U.S. Army Corps of Engineers and the Central and Southern Florida Flood Control District (CSFFCD), where the CSFFCD was later renamed the South Florida Water ManagementDistrict(SFWMD).
 
Interceptor ditch control system. The interceptor-ditch (ID) salinity-control system was designed to preventtheseepageofwaterfromtheCCSwestwardwithintheBiscayneAquifer. TheID,whichislocated immediatelytothewestoftheCCS,isoccasionallypumpedtocreateaseawardwater-tablegradientbetween the L-31E Canal to the west and the ID to the east, with the basis for the effectiveness of the ID control systembeingthatgroundwateroriginatingintheCCSwillbepreventedfrommigratingtowardsthewestin the presence of an eastward water-table gradient between the L-31E Canal and the ID. The ID is pumped whenanaturalseawardwater-tablegradientbetweentheL-31ECanalandtheIDdoesnotexist,andusually this is needed only during the dry season (November-April). The ID is adjacent and parallel to cooling-canalnumber32(CC-32)atthewesternendoftheCCS,andwasconstructedatthesametimeastheCCS.
TheIDisapproximately18-20ftdeep,30ftwide,and29,000ft(5.5mi)long. WithintheIDaretwopump stations, with each station containing two pumps, each capable of pumping up to 15,000gpm (21.6mgd).
There is no mechanism to transfer water between the ID and CCS, except for the 4 pumps at the two pump stations. The L-31E Canal, ID, and CC-32 are all approximately parallel to each other and run at an angle ofapproximately1738 westofsouth. TheperpendicularhorizontaldistancebetweentheL-31ECanaland the ID is about 1000ft. When the ID is pumped, there is a quick and measurable response in water levels in the L-31E Canal and the monitoring wells closest to the ID, indicating that there is good connectivity betweentheID,L-31ECanal,andnearbymonitoringwells.
Exhibit 17
 
14
 
Interceptorditchoperatingrule(1973-2011). TheIDoperatingrulethatwasfollowedfromtheinitial dateofoperationoftheCCSinFebruary1973upuntilDecember2011(i.e.,for38years)wasasfollows:
* Whenever the water-surface elevation in the L-31E Canal is more than 0.2ft higher than the water-surfaceelevationinCC-32,thereisaseawardwater-levelgradientandnopumpingisnecessary.
* Iftheabovecriterionisnotmet,aseawardgradientisstilltakentoexistifthewater-surfaceelevation in the L-31E Canal is more than 0.3ft higher than the water-surface elevation in the ID. Under this conditionnopumpingisnecessary.
* If neither of the above two criteria are met, pumping of the ID is initiated and the pumping rates are adjustedtomeetthe0.3-ftwater-leveldifferencecriterionbetweentheL-31ECanalandtheID.
* Pumpingisterminatedwhenthecriteriaforanaturalwater-tablegradientismet(withoutpumping).
 
Althoughthisoperatingruleisnolongerineffect,itisstillrelevanttothisanalysissincepossiblewestward migrationofsalinewaterfromtheCCSintotheBiscayneAquifercouldhaveoccurredwhilefollowingthis operatingrule. Thisconcernisdiscussedsubsequently.
 
Interceptor ditch operating rule (2011-present). A more conservative revised operating rule for the ID was initiated in December 2011 that considered freshwater piezometric-head equivalents rather than measured water-table elevations. This resulted in changes to the ID operating rule, and since December 2011theIDoperatingruleineffectisasfollows:
* If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is equal to or greaterthan0.30ftthennopumpingofIDisnecessary,andaseawardgradientexists.
* If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is less than 0.30ft, a natural seaward gradient might still exist if the L-31E Canal water-surface elevation mi-nus the ID water-surface elevation is equal to or greater than 0.30ft and the density of the water in the ID is less than or equal to 1012kg/m3. If a density in the ID is greater than 1012kg/m3, a higher elevation difference between L-31E and the ID is necessary and can be calculated by converting the surface-waterlevelstofreshwaterpiezometric-headequivalents.
* If a natural seaward gradient does not exist, create an arti"cial seaward gradient by pumping the ID untiltheIDismaintainedatanelevationdifferenceofatleast0.30-0.70ftbetweentheL-31ECanal andtheID,dependingonthedensityoftheIDwater.
 
Theprimarychangebetweenthisrevisedoperatingruleandthepreviousoperatingruleistheincreaseinthe L-31E/ID/CC-32water-leveldifferencecriteriaandtheconsiderationofvariable-densityeffects. Theuseof freshwaterpiezometric-headequivalentsprovidesamorerigorousapproachtotheoperationoftheID.
 
Effectiveness of the ID salinity-control system. Both the current and previous operating rules of the ID salinity-control system have limited salinity-control effects and do not prevent the landward migration of saline water originating from the CCS under all conditions. Following either of these operating rules, pumpingoftheIDreducesthewaterlevelintheIDbelowthatintheL-31ECanaltherebycreatingaseaward water-tablegradientandpresumablyprecludingwestwardmigrationofgroundwateroriginatingintheCCS.
However,pumpingwaterfromtheIDintotheCCSgenerallyelevatesthewater-surfaceintheCCSanditis Exhibit 17
 
15
 
possible for the water level in the CCS to be above the water level in the L-31E Canal, which then creates thepossibilitythatwateroriginatingintheCCScouldpassundertheIDevenwhenthepumpsintheIDare running to prevent this occurrence. Interestingly, this scenario was recognized in an early report prepared by the design engineers (Dames and Moore, 1971) based on results derived from an analog model of the system. Theanalogmodelshowedthatwestwardmigrationofthesaltwaterinterfaceispossibleevenifthe IDoperatingruleisfollowed. Further,Golder(2008)statedthatoperationoftheIDsalinity-controlsystem would prevent westward migration of CCS water at least in the top 18ft of groundwater. Measurements taken during ID pumping have in fact shown several occurrences where the water level in the CCS exceeds that in the L-31E Canal during ID pump operation, thereby indicating the possible ineffectiveness of the IDsalinity-controlsystem. Inactuality,thefunctioningoftheIDsalinity-controlsystemismoreaccurately characterizedasinterceptingshallowsalinegroundwateradjacenttotheIDthatisthenpumpedbacktothe CCS when the natural gradients are low and the potential for saltwater intrusion exists. It is possible that pumpingoftheIDundersomecircumstancessimplycreatesashallowsubsurface(groundwater)circulation in which water from the CCS "ows into the ID as groundwater that is subsequently returned to the CCS as pumped water. In support of this assertion, time series plots show that there are periods during pumping of the ID when the bottom-water temperatures in the ID rose along with an increase in speci"c conductance in the ID (Ecology and Environment, Inc., 2014). Aside from concerns regarding the effectiveness of the ID control system in mitigating saltwater intrusion, secondary concerns have also been raised that the ID control system contributes to the deterioration of groundwater quality in that it generally pumps less-saline waterfromtheIDintothehypersalineCCSwhichfurthercontributestoincreasedsalinityintheaquifer.
 
2 TemperatureVariationsintheCoolingCanals
 
The temperature in the CCS at the intakes to the power-generating units affect the ef"ciency and power output of the generating units that use water from the CCS. Both the ef"ciency and the power output of the generating units decrease with higher cooling-water temperatures. The practical upper limit of the intake cooling-water temperature is determined by the characteristics of the condensers and auxiliary heat exchangers in the generating units. In 2014 the Nuclear Regulatory Commission granted FPLs request to increase the maximum intake cooling-water temperature from 100F to 104F (37.8C to 40C). If the intakecooling-watertemperaturesintheCCSweretoexceed104F,thenFPLwouldberequiredtoreduce power output and possibly shut down one or more of the power-generating units. Since this occurrence wouldadverselyaffectalargenumberofcustomersintheSouthFloridaserviceregion,Miami-DadeCounty is obliged to work with FPL to "nd ways to avoid cutbacks in power generation resulting from elevated temperaturesintheCCS.
 
2.1 ResultsfromPreviousStudies 2.1.1 TemperaturesintheCCS Water temperatures in the CCS are almost always higher than synoptic temperatures of the overlying air, andtemperaturesintheCCSarealmostalwayshigherthantemperaturesinnearbyBiscayneBay. Analyses done by FPLs engineering consultants in around 2008 anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 2:5 F (1.4C) in the cooling water discharged to the CCS and an increase of 0:9 F (0.5C) in the temperature of the intake water (reported in SFWMD, 2008). These temperature changes were predicted to result in an increase in evaporation from the CCS of around 2-Exhibit 17
 
16
 
3mgd, and the increased evaporation was expected to increase the salinity in the CCS by 2-3. In contrasttotheaforementionedpredictions,ithasbeengenerallyreportedthattemperaturesintheCCShave actually increased by 5-9F (3-5C) in the post-uprate period compared with the pre-uprate period. In the summer of 2014 (during the post-uprate period), temperatures in the CCS were suf"ciently elevated as to prompt concern regarding the sustainability of the CCS as an adequate source of cooling water to the power-generatingunits. AccordingtoFPLsconsultant(EcologyandEnvironment,Inc.,2014),theincrease in CCS water temperatures in the post-uprate period cannot be attributed to the uprate since the total heat rejection rate to the CCS from Units 1, 2, 3, and 4, operating at full capacity prior to the uprate would have been higher than the post-uprate heat rejection rate to the CCS for Units 1, 3, and 4, operating at full capacity. Unit2 in the post-uprate period has been dedicated to operate in a synchronous generator mode andhencenotproducingsteamheat.
 
2.1.2 ThermalEf"ciencyoftheCCS Thethermalef"ciencyoftheCCSisameasureoftheabilityoftheCCStocoolthedischargedwaterdown to the background air temperature. An investigation of the thermal ef"ciency of the CCS was performed by Lyerly (1998), and these analyses indicated that the thermal ef"ciency of the CCS at the time of the study was equal to 86.4%. This ef"ciency was based on a 24-h average discharge temperature of 107 :3 F (41.8C),averageintaketemperatureof91:1 F(32.8C),andanaverageairtemperatureof88:6 F(31.4C).
In analyzing the temperature measurements, Lyerly (1998) noted that most of the cooling (i.e., most of the temperature decrease) occurs as the water in the CCS "ows from the (north) discharge location to (south) collector canal, with much less temperature decrease as the water "ows back from the collector canal to the (north) intake location. It is expected that the thermal performance varies with "ow rate and the state of the CCS, so the reported thermal ef"ciency should be regarded more as a snapshot of conditions at the timeofthemeasurementsthanasaconstantvalue. MorerecentmeasurementsbetweenJune2010andJune 2012 (Ecology and the Environment, 2012) show water temperatures in the CCS on the discharge side of the power-generating units being around 13.5F (7:5 C) warmer on average than at the intake side of the power-generatingunits. TheaveragetemperatureatthesouthendoftheCCSwasonly2F(1:1 C)warmer than at the intake side of the power-generating units, which supports the assertion that most of the cooling intheCCSoccursasthewater"owsfromnorthtosouth.
 
2.1.3 ThermalEffectsonGroundwater Measured groundwater temperatures in some wells between the ID and the L-31E Canal show higher tem-peratures than the groundwater west of the L-31E Canal, and this occurrence has been partially attributed tolimitedcooling-canalwaterintrusion(DamesandMoore,1977). Agroundwaterthermoclinehasbeen reported to exist in the area west of the CCS, which shows a sudden decrease in groundwater temperature at a particular depth in the aquifer. Measurements show that nearly all of the seasonal temperature "uc-tuations occur above an elevation of 25 ft NGVD. Below 25 ft NGVD, the groundwater temperature generally remains in the range of 75F-77F (24C-25C). The seasonal temperature "uctuations above
25 ft NGVD have been attributed to the heating and cooling of water in the L-31E Canal in response to seasonal changes in atmospheric conditions. Notably there is some temperature strati"cation in the L-31E Canal, in part due to the canal depth and limited "ow. The near-surface water temperatures in the L-31E Canal are almost always warmer than the bottom temperatures, and the surface temperatures exhibit more daily variability in response to air temperature changes. Aside from the groundwater adjacent to the L-31E Exhibit 17
 
17
 
Canal, it has also been reported (Ecology and Environment, Inc., 2014) that since groundwater in monitor-ing wells TPGW-2M and TPGW-2D is warmer than other nearby surface waters such as Biscayne Bay or fresh groundwater, the CCS might be in"uencing the groundwater temperatures in those wells. Based on the aforementioned evidence, it can be concluded that the environmental effects of elevated groundwater temperaturesduetotheoperationoftheCCSareinconsequential.
 
2.2 Heat-BalanceModelofCCS To fully understand the temperature dynamics in the CCS, it is necessary to have a validated heat-balance model of the CCS. In reviewing the documentation made available for this investigation, all indications werethatsuchamodeldoesnotcurrentlyexist,atleastnotinthepublicdomain. Historicaldocumentation shows that a heat-balance model was developed in the early stages of operating the CCS, as reported by Ray L. Lyerly Associates (1973), however, utilization of this model has not been subsequently reported.
As described by Lyerly (1973), the heat-balance model that was developed previously took into account such key components as the heat entering the water from the power-generating units, the net heat entering the water from shortwave solar radiation and longwave atmospheric radiation, and the latent heat transfer associated with evaporation. The input variables in the thermal model were the air temperature, relative humidity, wind velocity, and the net amount of radiation; the output variable was the water temperature in theCCS.
 
2.2.1 Heat-BalanceModelFormulation To investigate and understand the thermal dynamics within the CCS, a preliminary heat-balance model of the CCS was developed for this study. The CCS was divided into four zones as shown in Figure 3, where water in the CCS "ows sequentially through zones 1, 2, 3, and 4. The four delineated zones are the same
 
Figure3: Cooling-canalsystem
 
zones that are used in salinity-balance model of the CCS developed by the engineering consultant for FPL.
Exhibit 17
 
18
 
The measurement stations that characterize conditions within each of the four CCS zones were taken as TPSWCCS-1, TPSWCCS-2, TPSWCCS-4, and TPSWCCS-5, respectively, and the approximate locations of these measurement stations are shown in Figure 3. The average-daily temperature measurements within each of the CCS zones in the period 9/1/10-12/7/14 are shown in Figure 4. It is apparent from these
 
Figure4: TemperaturemeasurementsinCCS
 
measurements that the temperatures in the CCS decrease noticeably from zones 1 to 3 (i.e., moving from north to south in the CCS), with much less temperature change as the water moves back to the northern (cooling-waterintake)endoftheCCSthroughzone4. Therefore,almostallofthecoolingintheCCSoccurs in the south-"owing canals in the western portion of the CCS. It is further apparent from the temperature measurementsshowninFigure4thatthemidsummertemperaturesin2014(betweenJulyandAugust)were higher than the midsummer temperatures in previous years. For the period of record (9/1/10-12/7/14), the maximummeasureddaily-averagetemperatureinZone1was113F(44.9C)recordedon8/21/14,andthe maximum measured daily-average temperature in Zone 4 was 101F (38.3C) recorded on 8/22/14. Since the maximum allowable temperature at the cooling-water intake is 104F and measured temperatures in Zone 4 have been close to this limiting value (e.g., 101F recorded on 8/22/14), there is cause for concern.
Temperatures in Zone 4 near the 104F limit could force curtailment of power generation by one or more of the power-generating units, and cause power outages in South Florida. Given the elevated temperatures thathavebeenrecordedintheCCS,isnecessarytoidentifythefundamentalreasonsfortheseoccurrences, and to determine whether such occurrences are expected to continue in the future without any changes in the CCS and/or power-plant operations. To fully understand the temperature dynamics in the CCS it was necessarytodevelopaheat-balancemodeloftheCCS,whichisdescribedinthefollowingsection.
 
2.2.2 Heat-FluxComponents Theheat"uxeswithineachoftheCCSzonesareillustratedinFigure5,wherethevolumetricin"owrateand temperatureareQ 1 andT 1,respectively,andthecorrespondingquantitiesontheout"owsideareQ 2 andT 2.
Withineachzone,thereareseveralsourcesofenergythatarerepresentedinFigure5. Theseenergysources
 
Inthisreportheatandthermalenergyareusedinterchangeably.
Exhibit 17
 
19
 
Figure5: Energy"uxesinCCSzone
 
andtheirquanti"cationaredescribedbelow,where,forconsistencywiththermodynamicconvention,energy addedtoCCSistakenaspositiveandenergylossesaretakenasnegative.
 
Absorbedsolarradiation,(1 )R s. Theincidentsolar(short-wave)radiationisrepresentedbyR s [EL2 T 1]§,
andthealbedo(i.e.,re"ectivity)ofthewatersurfaceisrepresentedby [dimensionless];thereforethe amount of solar radiation that is absorbed within the zone is (1 )R s. The average solar radiation, R s, for each day in the four-year study (9/1/10-12/7/14) was obtained from the Florida Automated WaterNetwork(FAWN)stationlocatedonthepremisesoftheUniversityofFloridaTropicalResearch and Education Center (TREC) in Homestead, Florida. The albedo, , of a water surface is typically on the order of 0.1 for latitudes in the range of 20 -30 (Cogley, 1979), and a value of 0.1 was used as a reference value for this investigation. Factors such as the concentration of algae in the CCS can affect the value of , and therefore the sensitivity of the temperature dynamics within the zone to elevated algae concentrations was investigated by varying . The minimum value of is equal to zero, in which case all of the incident solar radiation is absorbed by the CCS and none is re"ected.
Hence, wasvariedwithintherangeof0-0.1.
 
Evaporationheat"ux,E h. Evaporation extracts heat from the CCS due to the latent heat of evaporation required to transform water from the liquid phase to the vapor phase. The evaporation heat "ux, E h [EL 2T 1],isgivenby E h = E fL v (1) where E [LT1 ] is the evaporation rate, f [ML 3] is the density of fresh water, and L v [EM 1]
is the latent heat of vaporization of water. The evaporation rate of water has long been known to decrease with increasing salinity (e.g., Harbeck, 1955; Salhorta et al., 1985). In the present study, daily evaporation rates, E, were calculated based on typical salinities in the CCS, measurements of water temperature, T s [], at the monitoring station within the zone, onsite measurements of air temperature, T a [ ] and relative humidity, RH [dimensionless] at station TPM-1, and measurements of wind speed,V w, at station TD. The freshwater density, f, in Equation 1, was taken as 994kg/m3, which is the approximate density of fresh water at 35C (95F). The latent heat of vaporization, L v, in Equation 1, is known to depend on both the temperature and salinity of the source (liquid) water. At a temperature of 35C, values of L v at salinities of 60 and 80 are 2.279MJ/kg and 2.229MJ/kg,respectively(Sharqawyetal.,2010),andanaverageof2.254MJ/kgwasusedforL v in theenergyanalysis. TheempiricalformulausedforestimatingE [cm/d],fromonsitemeteorological
 
§Termsinsquarebracketsindicatedimensions: E=energy,L=length,M=mass,T=time,and =temperature.
Exhibit 17
 
20
 
measurementsis E = C w (0:299+0:11V w )l{z}[ es(T s) RHes(T a)] (2)
 
= f (V w )
whereC w [dimensionless]isacalibrationconstant,f (V w ) = C w (0:299+0:11V w ) isawindfunction thataccountsfortheeffectofwindonevaporation,V w isthewindspeedinm/s, [dimensionless]isa factorthataccountsfortheeffectofsalinityonthesaturationvaporpressureofwater,andes(T ) [kPa]
is the saturation vapor pressure of water at temperature T. Equation 2 was used to calculate the evaporation for the sake of consistency with the previously developed salinity model of the CCS, where the constants C w and were taken as 0.69 and 0.885, respectively. In the salinity model, the value of C w was determined by calibration, and the value of was obtained from previous research on evaporation from saline water bodies reported by Salhorta et al. (1985). The evaporation formula givenbyEquation2hasanuncertainfunctionalform,particularlyforthewindfunctionf (V w ).
 
Uncertainty in the wind function. Wind functions used to estimate evaporation typically havethe form f (V w ) = a + bV w, where a and b are constants. Such a wind function is used in Equation 2.
In arti"cially heated waters, vertical convection is particulary important under low-wind conditions making speci"cation of the value of a a key parameter. The wind function used in Equation2 was originally proposed by Williams and Tomasko (2009) for heated waters, however, alternate formula-tions have been proposed by others (e.g., Brady et al., 1969; Ryan and Harleman, 1973). Notably, theformulationproposedbyRyanandHarleman(1973),andsubsequentlysupportedbyAdamsetal.
(1975),accountsfortheeffectofthetemperaturedifferencebetweentheheatedwaterandtheoverly-ing air in specifying the convection parametera in the wind function, which is a logical relationship thatisnotaccountedforintheothermodels(includingthemodelusedinthisstudy)andcouldbean importantconsiderationinaccountingforconvectiveheattransferatlowwindvelocities.
 
Rainfallheat"ux,R h. Rainfall that is cooler than the water in the CCS extracts thermal energy from the CCS because thermal energy in the CCS water is used to warm the rainwater. The heat "ux, R h [EL2T 1]duetorainfalldirectlyontheCCScanbeestimatedusingtherelation
 
R h = fcp f d r(T s T r)
 
where f [ML3 ] and cp f [EM1  1] are the density and speci"c heat of the (fresh) rainwater, re-spectively,d r is the depth of rainfall,T s [ ] is the temperature of the water in the CCS, andT r [ ] is thetemperatureoftherainfall. TherearenodirectmeasurementsofrainfalltemperatureattheTurkey Point site, however, it can be estimated that during a rainfall event the ambient air can be cooled by several degrees, and the temperature of raindrops approaches that of the cooled ambient air. Cooling effects of rainfall on the ambient air have been reported to be as high as 10C (Byers, 1949). On a global average, raindrops can have temperatures in the range of 32F-80F (0C-27C). For pur-posesofthepresentanalysis,thetemperatureoftherainfall,T r,wasassumedtobe68F(20C),and thecorrespondingvaluesof f andcp f weretakenas998kg/m3 and4.180kJ/kg C,respectively. The temperature dynamics in the CCS zones are relatively insensitive to the assumed temperature of the rainfall.
 
Atmosphericlongwaveradiation,L a. Anybodyofmatterwhosetemperatureisaboveabsolutezeroemits longwaveradiation. Longwaveradiation,L a [W/m2]emittedbytheatmospherecanbeestimatedus-Exhibit 17
 
21
 
ingtherelation(Chin,2013)
 
L a = (T a +273) 4(0:6+0:031 RHes(T a)(1 R L )
 
where is the Stefan-Boltzmann constant (= 4:903  10 9 MJm 2K 4d 1), T a [C] is the air tem-perature,RH[dimensionless]istherelativehumidity,es(T a) [mmHg]isthesaturationvaporpressure of water at temperature T a, and R L is the longwave re"ection coef"cient that can be taken as 0.03.
On cloudy days, atmospheric longwave radiation can be the greatest source of thermal energy at the watersurface.
 
Waterlongwaveradiation,L w. Water in the CCS also emits longwave radiation by virtue of its temper-ature being greater than absolute zero. Longwave radiation, L w [W/m2] emitted by the water in the CCScanbeestimatedusingtherelation(Chin,2013)
 
L w = (T s +273) 4
 
where is the emissivity of water that can be estimated as 0.97 [dimensionless], is the Stefan-Boltzmannconstantasgivenpreviously,andT s [C]isthetemperatureofthewaterintheCCS.
 
Heatinterchangewithsurroundingaquifer,G h. The CCS exchanges heat with the surrounding aquifer via seepage of groundwater into and out of the CCS, and conduction of heat between water in the CCS and groundwater in the surrounding aquifer. It is to be expected that the region immediately surroundingtheCCSisnormallycoolerthanthewaterintheCCS,inwhichcasetherewillbecooling oftheCCSwaterduetoheatconductionbetweentheCCSandthesurroundingaquifer,coolingdueto seepage in"ow from the surrounding aquifer into the CCS, and no cooling or heating due to seepage out"ow from the CCS into the surrounding aquifer. The cooling heat "ux due to conduction can be assumed to negligible compared to the heat "ux due to seepage in"ow. The heat "uxG h [EL 2T 1]
duetoseepagein"owisproportionaltothetemperaturedifferencebetweenthewaterintheCCSand thegroundwaterinthesurroundingaquiferandcanbeestimatedbytherelation
 
G h = gcp g Q sgA s T sg
 
where g [ML3 ]andcp g [EM 1 1 ]arethedensityandspeci"cheat,respectively,ofthegroundwa-tersurroundingtheCCS,Q sg [L3T1 ]istheseepagein"owtotheCCSfromthesurroundingaquifer, A s [L2] is the area of the CCS zone, and T sg [] is the difference between the temperature in the CCS,T s [ ],andthetemperatureonthesurroundinggroundwater,T g [](i.e., T sg = T s T g)
 
Conductionheat"ux,C h. The conduction heat "ux is associated with the sensible transfer of heat be-tween the CCS water and the air above the CCS. The conduction heat "ux, C h [W/m2] can be esti-matedusingtheempiricalrelation(Chin,2013;Chapra,1997)
 
C h = c B f (V w )(T s T a)
 
wherecB isBowenscoef"cient,and f (V w ) isthewindfunctionasde"nedinEquation2. Following the guidance given in Chin (2013) and Chapra (1997), the value of cB can be estimated as 0.063.
According to Martin and McCutcheon (1998), sensible heat transfer from lakes and reservoirs to the overlying air due to conduction and convection is a relatively small component of the heat balance Exhibit 17
 
22
 
equation that is poorly understood, and Brown and Barnwell (1987) have noted that the conduction heat "ux from lakes and reservoirs to the overlying air calculated by heat-transfer theory is normally small enough to neglect. Given the aforementioned considerations, conduction of heat between the CCSandtheoverlyingairwasneglectedinthisanalysis.
 
Based on the component heat "uxes described above, the net heat "ux, _H C [EL2 T 1], into the CCS is givenby 4{ }
_H C = [(1 )R s + E h + R h + L a + L w + G h ]i A i (3)
 
i=1 wherei isanindexthatreferstoeachzonewithintheCCS,A i [L2]istheareaofZonei,andthesummation isoverthefourzoneswithintheCCS.TheareasofeachofthezonesintheCCSaregiveninTable1,andthe total area of the CCS is approximately 1907ha (= 4712ac). The heat extracted from the CCS by pumping
 
Table1: CCSZonalAreasinEnergyandSalinityModels
 
Area Zone (ha) 1 368.0 2 795.1 3 396.6 4 347.0 Total 1906.7
 
cooler water from the ID into the CCS was calculated in a similar manner to the method used to calculate thecoolingeffectofrainfall,wheretheeffectiverainfallrateisequaltothevolumeofwaterpumpedfrom the ID divided by the area of the CCS. Assuming (conservatively) that the temperature difference between the ID water and the CCS water is 10C (50F), the cooling effect of pumped ID water was found to be negligiblecomparedwithothercomponent"uxesintheheat-balanceequation.
 
2.2.3 Heat-BalanceEquations Under steady-state conditions, conservation of thermal energy requires that the net rate at which heat is added to the CCS is equal to the difference in thermal energy between the water leaving the CCS and the waterenteringtheCCS.Thisrelationshipisexpressedbythefollowingequation,
_H C = scp sQ (T 4 T 1) (4)
 
where s andcp s are the density and speci"c heat of the CCS water,Q is the "ow rate of water through the CCS, T 4 the temperature of the cooling water at the intake of the power plant (in Zone 4), and T 1 is the temperatureofthecoolingwateratthedischargefromthepowerplant(inZone1). Ifthepower-generating unitsaddheattothewateratarate _H G,thenbetweentheintakeanddischargeendofthepower-generating unitstheheat-balanceequationisgivenby
 
_H G = scp sQ (T 1 T 4) (5)
Exhibit 17
 
23
 
Combining Equations 3, 4, and 5 requires that the heat rejection rate in the power-generating units, _H G, is relatedtothenetrateatwhichheatisaddedtotheCCS, _H C,bytherelation
 
4{ }
_H G = [(1 )R s + E h + R h + L a + L w + G h ]i A i (6) i=1
 
This equation can be used to estimate the heat-rejection rate, _H G, of the power-generating units based on "eld measurements that are used to calculate the terms on the righthand side of Equation 6. In cases where daily time steps are used, estimated values of _H G might "uctuate about a mean value and be dif"cult to discern. Insuchcases,theaverageheat-rejectionrate, _H G J,overaperiodofJ timestepscanbeestimated usingtherelation J
_H G J = 1J t_H G t (7) j=1 where t is the duration of each time step. In accordance with Equation 7, a constant heat rejection rate canberecognizedbyplottingthecumulativeestimatedheatrejectionrate, Jj=1 _H G t,versustime, J t, which would would result in a straight line of constant slope equal to _H G J. This relationship was used in this study to identify periods of constant heat rejection rate of the power-generating units that utilize the CCS.
 
2.2.4 ModelResults The heat-balance model was applied to each of the four zones within the CCS to determine the net heat "ux into each zone, and the results from all zones were combined to determine the net heat "ux into the entireCCS.Theenergymodelwasappliedatdailytimestepsfortheperiodofrecord9/1/10-12/7/14. The thermal-energy dynamics within each of the CCS zones are similar, and the "uctuations of the heat-"ux componentsinZone1willbeusedtodemonstratethethermal-energydynamicswithineachzone.
 
Zone1heat-"uxcomponents. Thelongwaveradiationandshortwavesolarenergy"uxesasafunctionof time are shown in Figure 6(a), and the evaporation and rainfall heat "uxes as a function of time are shown in Figure 6(b). It is apparent that the shortwave and longwave energy "uxes vary seasonally, and that there
 
Figure6: Energy"uxesinZone1 Exhibit 17
 
24
 
is much more seasonal variation in the shortwave solar radiation than in the longwave radiation. The net longwave radiation has a cooling effect (i.e. net negative heat "ux) which contributes to a net-radiation coolingoftheCCSwateratnightwhenthesolarradiationiseffectivelyzero. ItisapparentfromFigure6(b) that evaporation and rainfall generally have a cooling effect, with evaporation usually having the greater coolingeffectandrainfallhavingalessercoolingeffect. Theconvectiveheat"uxbetweentheCCSandthe adjacentgroundwater,G h,isnotshowninFigure6becausethemagnitudeofG h isgenerallymuchsmaller thattheheat"uxduetorainfallandthereforehasaminimalimpactontheheatbalancewithintheCCS.
 
Heat rejection rate of the power-generating units. To determine the thermal dynamics in the entire CCS, the component heat "uxes were determined for each zone within the CCS, and these heat "uxes were combined in accordance with Equation 6 to determine the thermal energy that is added to the CCS by the power plant (i.e., the heat-rejection rate). The cumulative heat-rejection from the power plant as a function of time for the entire CCS is shown in Figure 7. It is apparent from Figure 7 that there are two
 
Figure7: Cumulativeheatrejectionratefromthepowerplant
 
periodsduringwhichtheheatrejectionrateisapproximatelyconstant. The"rstperiod,shownasPeriod1in Figure 7, covers the time interval 9/1/10-2/1/13, and the second period (Period2) covers the time interval 7/1/13-12/1/14. Notably, Period1 includes the pre-uprate period before May 2013 and Period2 includes the post-uprate period after May 2013. During Period1, the average heat-rejection rate is estimated to be around 2800MW, and during Period2 the average heat-rejection rate is estimated to be around 5500MW.
Although these estimated heat rejection rates are preliminary estimates and derived from an uncalibrated heat-balance model, the distinct difference in heat-rejection rates between the two periods is clear, and the numerical estimates of the heat-rejection rates during these two periods are reasonable given the capacities ofthepower-generatingunitsservicedbytheCCSandtheenergyef"cienciesnormallyassociatedwithboth fossil-fuelandnuclearpowerplants. AlogicalinferencefromtheresultsshowninFigure7isthattheuprate inpower-generatingcapacityofthetwonuclearunits(Units3and4)hascausedthetotalheat-rejectionrate from the power plant to increase signi"cantly. This "nding is not inconsistent with the condition that the post-uprate generating capacity of the power plant served by the CCS is less than the pre-uprate generating Exhibit 17
 
25
 
capacity (due to Unit2 operating in synchronous generator mode). This is so because in the post-uprate generating capacity there is a signi"cant shift from fossil-fuel generation to nuclear-power generation, and nuclear-power units are known to have a much higher heat-rejection rates to cooling water than fossil-fuel generatingunits,whichreleaseasigni"cantportionoftheirwasteheatin"ue-gasemissions.
 
Effect of algae. It is assumed that the algae content of the CCS affects the heat balance in the CCS by increasing the amount of solar energy that is absorbed by the CCS. Consequently, the effect of algae in the CCS was investigated by reducing the albedo (i.e., re"ectivity), , of the water surface from 0.1 to 0.0 starting on January 1, 2014. An albedo of 0.1 was used in the normal simulations presented in Figure7sincethisisthetypicalvalueof thatisassociatedwithwatersurfacesatsubtropicallatitudes;this corresponds to 90% of the incident solar radiation being absorbed by the water in the CCS. Assuming that the effect of algae is to retain more solar heat, then taking = 0 re"ects the extreme case where the CCS with high concentrations of algae absorbs 100% of the incoming solar radiation. The effect of reducing from 0.1 to 0.0 on the estimated cumulative heat-rejection rate is shown in Figure 8. It is apparent that the
 
Figure8: Estimatedalgaeeffectonestimatedcumulativeheatrejectionratefromthepowerplant
 
impactofthehigherabsorptionrateofsolarenergyattributedtohighalgaeconcentrationsisrelativelysmall comparedwiththeheatrejectionrateofthepower-generatingunits. Inquantitativeterms,theincreasedrate ofheatingoftheCCSduetoreducedre"ectionofsolarenergyisaround400MW,comparedwithanormal heat rejection rate of around 5700MW (in 2014). This indicates that the (maximum) rate of increased heating caused by algae is only around 7% of the normal heat-rejection rate, and hence there is a relatively smallheatingeffectcausedbyalgaeintheCCS.
 
Relationshipbetweenincreasednetheat"uxandtemperature. Anincreasedheat-rejectionratewould be expected to increase the temperature in the CCS relative to the temperature of the overlying air. Repre-senting the temperature in the CCS as T s, and the temperature of the overlying air as T a, this temperature differenceisT s T a. ThevariationofT s T a asfunctionoftimeforeachofthefourCCSzonesisshown Exhibit 17
 
26
 
in Figure 9, where the average temperature difference during Period1 and Period2 are shown as horizon-tal lines. It is apparent from Figure 9 that the increase in the average heat-rejection rate from Period1 to
 
Figure 9: Temperature differences between CCS and overlying air. Horizontal lines show intervals of con-stantheat-additionrates.
 
Period2 corresponds to an increase in the average value of T s T a. Representing the average value of T s T a during Period1 asT 1 and the average value ofT s T a during Period2 asT 2, these averaged values for each CCS zone are shown in Table2, along with the corresponding standard deviations, S 1 and S 2, respectively. These results show that in Zone1, which accepts the cooling-water discharge, the average temperature difference between the CCS and the overlying air has increased from 9.6C (18F) to 13.1C (23.6F), which corresponds to an average temperature increase of 3.5C (6.3F). In Zone4, which con-tains the cooling-water intake, the average temperature difference between the CCS and the overlying air has increased from 2.8C (5.0F) to 5.4C (9.7F), which corresponds to an average temperature increase of 2.6C (4.7F). These changes in average temperature can be contrasted with previous (pre-uprate) pre-dictions made by FPLs engineering consultants in 2008 where it was anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 1.4C (2.5F) in the discharged cooling water (to Zone1)andanincreaseof0.5C(0.9F)inthetemperatureoftheintakewater(fromZone4). Thestandard deviations of the temperature "uctuations are similar across all zones, and have shown relatively modest decreases between the pre-uprate and post-uprate periods. Of particular interest, in Zone1 the standard de-viationdecreasedfrom3.8C(6.8F)to3.3C(5.9F),andinZone4thestandarddeviationdecreasedfrom 3.9C(7.0F)to3.5C(6.3F).
Exhibit 17
 
27
 
Table2: TemperatureStatisticsinCCS
 
Period1 Period2 T 1 S 1T 2 S 2 T 2 T 1 Zone (C) (C) ( C) ( C) ( C) ( F) 1 9:6 3:8 13:1 3:3 3 :5 6:3 2 4:6 3 :7 8:4 3:7 3 :8 6:8 3 2:9 3 :9 5:5 3:6 2 :6 4:7 4 2:8 3 :9 5:4 3:5 2 :6 4:7
 
Thermal ef"ciency. The thermal ef"ciency, t, of the CCS is a measure of the ability of the CCS to cool the water down to the background air temperature. The thermal ef"ciency of the CCS was previously measuredbyLyerly(1998)usingtherelation
 
t = 1 T i T aT d T a (8)
 
where T d and T i are the temperatures of the cooling water at the discharge and intake ends of the power plant, respectively, and T a is the temperature of the ambient air above the CCS. The thermal ef"ciency of theCCScanbeestimatedusingEquation8byreplacingT d T a bytheaveragevalueofT s T a inZone1, andreplacingT i T a bytheaveragevalueofT s T a inZone4. Usingtheaveragedtemperaturedifferences giveninTable2inEquation 8gives:
 
Period1: t = 1 2:89:6 = 0:71; Period2: t = 1 5:413:1 = 0:59
 
These results indicate that the thermal ef"ciency of the CCS in Period1 is around 70% and the thermal ef"ciency of the CCS in Period2 is around 60%. Hence, the thermal ef"ciency of the CCS has apparently decreased between Period1 and Period2. The reason for this decrease in thermal ef"ciency is not readily apparent and could be due to a variety of factors, including increased thermal loading and increase algae concentrations in the CCS. It should be noted that the thermal ef"ciency of 86% reported by Lyerly (1998) is not directly comparable to the values calculated here, since the additional cooling between the discharge location and the Zone1 temperature measurement station, as well as the additional cooling between the intake location and the Zone4 temperature measurement location are not taken into account in the present analysis.
 
2.2.5 Conclusions The results derived from the heat-balance model indicate that the rate of heat addition to the CCS has in-creased signi"cantly during the period of record, and that the increased heat-addition rate is manifested in anincreaseintheaveragetemperatureintheCCSrelativetothetemperatureoftheoverlyingair. Itappears that the most likely cause for the increased heat-addition rate is an increased heat-rejection rate from the power-generating units. Notably, the increased heat-addition rate began shortly after the beginning of the post-uprate period. As a result of the increased heat addition to the CCS, the average temperature in the intakezone(Zone4)hasincreasedbyapproximately2.6C(4.7F). Interestingly,thismeasuredincreasein Exhibit 17
 
28
 
average temperature is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2C (4.0F)¶ approved by the Nuclear Regulatory Commission in 2014. There-fore, the increased maximum allowable operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, and might have slightly increased the probability of exceeding the threshold temperature. This serves as a cautionary note regarding further increases in power generation beyond 2014 levels without providing a supplementary system to cool the water in the CCS. Others have cited increased algae concentrations in the CCS as being as a possible reason for elevated temperatures of the water in the CCS. However, a sensitivity analysis indicates that changes in the algae-in"uenced solar re"ectivityoftheCCSwithinarealisticrangeareunlikelytohavebeenofsuf"cientmagnitudetocausethe observed changes in temperature, nor stimulate the sudden change in heat-addition rate that was observed almost immediately after the beginning of the post-uprate period. There are indications that the thermal ef"ciency of the CCS has decreased signi"cantly between the pre-uprate and post-uprate periods. Further investigation is recommended to con"rm this "nding and to identify the factor(s) causing the reduced ther-malef"ciency.
 
Limitationsoftheheat-balancemodel. Theheat-balancemodeldevelopedforthisstudyisbasedonthe best estimates of all of the heat-balance components that in"uence the temperature in the CCS. However, the heat-balance model has not been calibrated due to lack of available data for calibration. Data required to calibrate the heat-balance model would include synoptic measurements of the "ow rate and temperature differences between the intake and discharge structures of the power-generating units, and synoptic tem-peratures and "ow rates at the in"ow and out"ow faces of each CCS zone. Calibration of the heat-balance model would not necessarily change the key inferences that have been drawn from the uncalibrated model, namely that there has been a signi"cant increase in the heat-rejection rate from the power-generating units during the post-uprate period, and that increased algae concentrations and increased ambient temperatures are not the most likely causes of elevated temperatures in the CCS. Further development of a calibrated heat-balancemodeliswarrantedtocon"rmtheconclusionsthathavebeendrawn.
 
3 SalinityVariationsintheCoolingCanals
 
Salinityisde"nedasthemassofdissolvedsaltsperunitmassofsolution,andisusuallyreporteddirectlyin unitsofeitherpartsperthousand()orasadimensionlessnumberonthepracticalsalinityscale1978(PSS-78). Salinities are sometimes expressed indirectly in terms of chlorinity (mg/L chloride) or conductance (mS/cm). In this report, salinities are expressed in units of parts per thousand (), which gives salinities approximatelyequalinmagnitudetosalinitiesexpressedinPSS-78. Asreferencepoints,averageseawaterat 25Chasasalinityof35,achlorinityof19.84g/L,andaspeci"cconductanceof54.7mS/cm. Hypersaline water is typically de"ned as water with a salinity greater than 40 or a speci"c conductance greater than 61.5mS/cm, and brine is typically de"ned as water with a salinity greater than 50. These hypersalinity andbrinethresholdsareroutinelyexceededintheCCS,andthereforewaterwithintheCCScanbeproperly classi"edeitherasbeinghypersalineorasbrine.
 
¶From37.8 Cto40 C(100 Fto104 F)
Exhibit 17
 
29
 
3.1 ResultsfromPreviousStudies There has been a continuous upward trend in salinity since the CCS began operation in August 1973, and thistrendisclearlyapparentinFigure10,whichshowsthemaximumreportedsalinitiesintheCCSsincethe initialNPDESreportwassubmittedin1973. Thelong-termtrendofincreasingsalinityshowninFigure10
 
Figure10: MaximumobservedsalinitiesintheCCSsinceinitialoperation
 
canbeapproximatedasbeinglinear(asshownbythelineartrendline)withasalinityincreaseofaround5 per 10years. It is also apparent from Figure 10 that the rate of increase in salinity might have accelerated since 2013. The salinity in the CCS when it was "rst put into operation was around 26.5, with the contemporaneous salinity in Biscayne Bay being around 33 (Lyerly, 1973). The average CCS salinity in 1998 was reported to be in the range of 38-50 (Lyerly, 1998), and in May 2014, the salinity in the CCS wasreportedtobeashighas95.
 
Salinity-controlprocesses. ThekeyprocessesaffectingthesalinityintheCCSare: rainfall,evaporation, andgroundwaterexchangebetweentheCCSandthesurroundingaquifer. AverageannualrainfallatTurkey Pointisapproximately60inches,andthenaturalannualevaporationatTurkeyPointisapproximatelyequal to the average annual rainfall. Actual evaporation of water from the CCS exceeds natural evaporation due to the elevated temperatures in the CCS. The steady increase in salinity since operation of cooling canals beganintheearly1970s(asshowninFigure10)hasbeenmostcommonlyattributedtoevaporationexcess overrainfall.
 
3.1.1 HistoricalChlorideLevels Chlorideconcentrations(i.e.,chlorinities)intheCCSbetweenJune2010andJune2012wereintherangeof 26-46g/L with an average chlorinity of 33.9g/L. The average chlorinity in Biscayne Bay during the same period was 18.9g/L (Ecology and Environment, Inc., 2012). There is little difference (less than 10%) in chlorideconcentrationbetweensamplescollectednearthesurfaceornearthebottomatanygivensampling location within the CCS canals. Chloride concentrations in the CCS during the post-uprate period were observedin range of 27.0-49.8g/L, with the highest valuesobserved in March 2014 and the lowest values inJune2013(EcologyandEnvironment,Inc.,2014).
Exhibit 17
 
30
 
3.1.2 HistoricalSpeci"cConductanceLevels Speci"c conductances in the CCS between June 2010 and June 2012 were in the range of 70-90mS/cm.
Speci"cconductanceintheCCShasbeenrisingsincethebeginningofthedryseasonin2014andreached over 120mS/cm in May 2014. The average post-uprate speci"c conductance for all CCS stations was reported as 92.6mS/cm, and this average value was over 15mS/cm higher than the average value reported inthepre-uprateperiod.
 
3.2 Salinity-BalanceModelofCCS The salinity-balance model of the CCS that is currently being used to simulate salinity variations in the CCS was developed by engineering consultants for FPL. The salinity-balance model uses a "nite-control-volume approach in which the control volume is de"ned to include the canals of the CCS and the adjacent interceptor ditch (ID). The salinity-balance model is closely related to a companion water-balance model, withbothmodelshavingbeendevelopedbythesamecontractoranddescribedbyEcologyandEnvironment, Inc.(2012). Forpurposesofthecurrentanalyses,thispreviouslydevelopedmodelwillbeacceptedasvalid andtherelevantcomponentsofthemodelformulationaredescribedinthefollowingsection.
 
3.2.1 Salinity-BalanceModelFormulation Component salinity "uxes into and out of the de"ned control volume are determined by multiplying the water (volume) "ux by the corresponding salinity. The components of the water balance model are the lateral and vertical seepage into the CCS, blowdown water (i.e., additional water pumped from other units totheCCS),rainfall(includingrunofffromearthbermsbetweencanals),andevaporation. Thekeyfeatures ofthesalinitymodelareasfollows:
* The base of the control volume is assumed to be the bottom of the ID and the cooling canals, whose elevationrangesfromapproximately 3 ftfeetNAVDll toapproximately 30 ftNAVD.Theelevation of bottom of the ID is approximately 20 ft NAVD. Sloping sidewalls of the canals in the CCS are takenintoaccountbyexpressingthewater-surfaceareaasafunctionofthewater-surfaceelevation(s) intheCCS.
* Lateral seepage of water and salt between the L-31E Canal and the control volume is calculated directly from the product of the calibrated hydraulic conductivity and the difference in water-surface elevationsbetweentheL-31ECanalandtheID.
* LateralseepageofwaterandsaltbetweenBiscayneBayandthecontrolvolumeiscalculateddirectly fromtheproductofthecalibratedhydraulicconductivityandthedifferenceinwater-surfaceelevations betweentheCCSandBiscayneBay.
* Verticalseepageofwaterandsaltthroughthebottomofthecontrolvolumeiscalculateddirectlyfrom theproductofthecalibratedhydraulicconductivityandthedifferenceinthewater-surfaceelevations intheCCSandthemeasuredandestimatedpiezometricheadsbeneaththeCCS.
* Evaporation is estimated using Equation2, which uses meteorological data collected from meteoro-logicalstationsinandimmediatelytothenorthandsouthoftheCCS.
 
llNAVDreferstotheNAVD88datum.
Exhibit 17
 
31
* RainfallisestimatedusingNextGenerationWeatherRadar(NEXRAD)precipitationdataprovidedby theSFWMD.Runoffintothecontrolvolumefromearthbermsbetweencanalsisusedasacalibration parameterandisinitiallyassumedtobe50%oftherainfallthatfallsontheberms.
* Added water from Units 3 and 4 are assumed to be freshwater (non-saline); Unit 5 blowdown salin-ities are adjusted to between 20% and 80% of seawater (35), with the exact percentage used as a calibrationparameter.
* TheIDcontrolsystemissimulatedtooperateprimarilybetweenthemonthsofJanuaryandJune;with pumpingratesashighas50mgdandaveraging4.5mgdoverthecalibrationperiod.
* The water-budget model is calibrated "rst by minimizing the errors between the simulated and ob-served storage in the control volume. Parameters adjusted during calibration of the water-budget model included the hydraulic conductivities in the aquifer adjacent to and beneath the CCS, an evap-oration factor that adjusts the coef"cients in the wind function, the amount of runoff that enters the control volume as percentage of precipitation, and the amount of Unit 5 cooling-tower water that is losttoevaporationbeforeenteringtheCCS.Thesalinitymodelusesmeasuredsalinitiesinandaround theCCS.
 
Calibrated values of the horizontal hydraulic conductivities in the aquifer surrounding the control volume have been found to be in the range of 500-950ft/d, and calibrated values of the vertical hydraulic con-ductivities beneath the control volume have been found to be in the range of 0.1-4ft/d. Vertical hydraulic conductivities beneath the northern discharge canals and beneath the return canals, where it is assumed deeper canals intersect highly permeable material underlying the muck and Miami Limestone Formation, were calibrated to have (higher) vertical hydraulic conductivities of 3.8ft/d and 4ft/d, respectively. Lower vertical hydraulic conductivities of 0.1ft/d were calibrated for the mid-and southern portions of the dis-charge canals, as well as the southern portion of the return canals. Calibration of the salinity model was doneentirelybytheFPLcontractor.
 
3.2.2 PreviousModelResults The model was run to simulate salinity variations both before the uprate (i.e., before November 2012) and after the uprate (i.e., after May 2013). The results of these model simulations are useful in understanding thesalinitydynamicsintheCCSandaredescribedbelow.
 
Pre-uprate model results. The salinity model was calibrated for a 22-month pre-uprate period and the results showed an average volume out"ow rate from the CCS of 0.62mgd, with monthly-averaged out"ow ratesrangingfrom 46:6 mgd(October2010)to+52 :1 mgd(September2010)(EcologyandEnvironment, Inc.,2012). Net"owthroughthebottomoftheCCSwasgenerallyoutwardbetweenthedry-seasonmonths of September through February, and inward during the wet-season months. Average in"ow from precipita-tion during the wet season was more than twice that for the dry season. It was reported that vertical "ows intoandoutofthecontrolvolumeweresubstantiallylargerthanlateral"ows.
 
Post-uprate model results. A second round of salinity-model results was reported for the post-uprate period of June 2013-May 2014 (Ecology and Environment, Inc., 2014). The results showed an average out"ow rate of 3.26mgd, with monthly-averaged out"ow rates ranging from 31:1 mgd (June 2013) to Exhibit 17
 
32
 
+19 :6 mgd(July2013). Duringthepre-uprateandinterimoperatingperiod,(September2010toMay2013),
precipitation accounted for 39.4% of in"owing water to the CCS and evaporation accounted for 63.7% of the out"owing water from the CCS. There was an average rate of increase of salt in the CCS during the post-uprate period of 2:2  10 6 lb/d, which was attributed primarily to the combined effects of low rainfall and high evaporation. These model simulations were able to match the summer 2014 rise in salinity from approximately60toapproximately90.
 
3.2.3 AnalysisofSalinityDynamics The primary drivers of salinity variations in the CCS are rainfall, evaporation, and seepage exchanges be-tween the CCS and the surrounding aquifer. Pumpage from the ID can also in"uence salinity variations in the CCS, but its role is secondary to that of the aforementioned processes. Evaporation increases the salin-ity,rainfallandIDpumpagedecreasethesalinity,andseepageinterchangewiththesurroundingaquifercan eitherincreaseordecreasethesalinitydependingonotherfactors.


Exhibit 17 32
+19.6 mgd (July 2013). During the pre-uprate and interim operating period, (September 2010 to May 2013),
precipitation accounted for 39.4% of inflowing water to the CCS and evaporation accounted for 63.7% of the outflowing water from the CCS. There was an average rate of increase of salt in the CCS during the post-uprate period of 2.2 x 106 lb/d, which was attributed primarily to the combined effects of low rainfall and high evaporation. These model simulations were able to match the summer 2014 rise in salinity from approximately 60 to approximately 90.
3.2.3 Analysis of Salinity Dynamics The primary drivers of salinity variations in the CCS are rainfall, evaporation, and seepage exchanges be-tween the CCS and the surrounding aquifer. Pumpage from the ID can also influence salinity variations in the CCS, but its role is secondary to that of the aforementioned processes. Evaporation increases the salin-ity, rainfall and ID pumpage decrease the salinity, and seepage interchange with the surrounding aquifer can either increase or decrease the salinity depending on other factors.
Salinity variations under dry conditions. Under conditions of no rainfall (i.e., dry conditions), salin-ity in the CCS is primarily controlled by evaporation, and the salinity in the CCS steadily increases with time. Evaporation removes pure water from the CCS, and the volume of pure water that is evaporated is replenished by the seepage of saline water into the CCS from the surrounding aquifer. Since the CCS is directly connected to the surrounding aquifer, the water surface elevation within the CCS remains close to the water-table elevation in the surrounding aquifer which changes over relatively long time scales (viz.
Salinity variations under dry conditions. Under conditions of no rainfall (i.e., dry conditions), salin-ity in the CCS is primarily controlled by evaporation, and the salinity in the CCS steadily increases with time. Evaporation removes pure water from the CCS, and the volume of pure water that is evaporated is replenished by the seepage of saline water into the CCS from the surrounding aquifer. Since the CCS is directly connected to the surrounding aquifer, the water surface elevation within the CCS remains close to the water-table elevation in the surrounding aquifer which changes over relatively long time scales (viz.
months) compared to the shorter time scales (viz. days, weeks) over which significant salinity variations are observed. Small differences between the water-surface elevations in the CCS and the water-table elevations in the adjacent aquifer are proportional to the seepage interchange between these two bodies of water. Over shorter time scales (viz. days) the evaporated volume of pure water is approximately equal to the seepage inflow volume of saline water, and the volume of water within the CCS remains approximately constant.
months)comparedtotheshortertimescales(viz. days,weeks)overwhichsigni"cantsalinityvariationsare observed. Smalldifferencesbetweenthewater-surfaceelevationsintheCCSandthewater-tableelevations intheadjacentaquiferareproportionaltotheseepageinterchangebetweenthesetwobodiesofwater. Over shorter time scales (viz. days) the evaporated volume of pure water is approximately equal to the seepage in"ow volume of saline water, and the volume of water within the CCS remains approximately constant.
This mechanism results in an increased mass of salt in an unchanged CCS volume, and hence an increase in salinity.
ThismechanismresultsinanincreasedmassofsaltinanunchangedCCSvolume,andhenceanincreasein salinity.
Salinity variations under wet conditions. When rainfall occurs (i.e., wet conditions), salinity is primarily controlled by the difference between evaporation and rainfall. Conditions under which evaporation exceeds rainfall result in the net removal of pure water from the CCS and the dynamics of salinity variations under this condition are similar to those described previously for evaporation without rainfall. Hence, for time intervals where evaporation exceeds rainfall, the salinity in the CCS can be expected to increase. For time intervals where rainfall exceeds evaporation, there is a net inflow of (approximately) pure water into CCS that is equal to the difference between the rainfall and evaporation volumes, and this inflow is approximately balanced by the volume of saline water that seeps out of the CCS into the surrounding aquifer. The salinity of the seepage outflow is approximately equal to the salinity of the water within the CCS. This mechanism results in a decreased mass of salt in the CCS in an unchanged volume, and hence a decrease in salinity.
 
Salinity variations under ID pumping. Pumping water from the ID into the CCS has a relatively minor effect on the salinity in the CCS relative to rainfall and evaporation, since the volume of pumped water is relatively smaller and the difference in salinity between the pumped water and the water in the CCS is also less than for evaporation and rainfall.
Salinityvariationsunderwetconditions. Whenrainfalloccurs(i.e.,wetconditions),salinityisprimarily controlledbythedifferencebetweenevaporationandrainfall. Conditionsunderwhichevaporationexceeds rainfall result in the net removal of pure water from the CCS and the dynamics of salinity variations under this condition are similar to those described previously for evaporation without rainfall. Hence, for time intervals where evaporation exceeds rainfall, the salinity in the CCS can be expected to increase. For time intervals where rainfall exceeds evaporation, there is a net in"ow of (approximately) pure water into CCS thatisequaltothedifferencebetweentherainfallandevaporationvolumes,andthisin"owisapproximately balanced by the volumeof saline waterthat seeps out of the CCS into the surrounding aquifer. The salinity of the seepage out"ow is approximately equal to the salinity of the water within the CCS. This mechanism resultsinadecreasedmassofsaltintheCCSinanunchangedvolume,andhenceadecreaseinsalinity.
 
SalinityvariationsunderIDpumping. Pumping water from the ID into the CCS has a relatively minor effect on the salinity in the CCS relative to rainfall and evaporation, since the volume of pumped water is relatively smaller and the difference in salinity between the pumped water and the water in the CCS is also lessthanforevaporationandrainfall.
Exhibit 17
 
33
 
3.2.4 DemonstrationofSalinityDynamics The mechanism driving salinity changes in the CCS can be demonstrated using the previously calibrated salinitymodel. Thecumulativerainfall,evaporation,seepagein"ow,IDpumpage, andwaterstorage(=net in"ow) within the CCS between September 2010 and April 2014 are shown in Figure 11. It is apparent
 
Figure11: Waterin"owintoCCS
 
from Figure 11 that the storage in the CCS remains relatively constant compared with cumulative rainfall, evaporation, ID pumpage, and seepage in"ow. Further, it can be asserted from Figure 11 that the seepage in"owadjuststothedifferencebetweenevaporationandrainfall-plus-ID-pumpagesoastokeepthevolume of water within the CCS approximately constant. The cumulative evaporation and rainfall in Figure 11 show approximately linear trends, with the evaporation trend line showing an average evaporation rate of approximately39mgd,andtherainfalltrendlineshowinganaveragerainfallrateofapproximately21mgd.
 
Distribution of seepage in"ows and out"ows. Seepage "ow to the CCS does not occur uniformly over the interfaces of the CCS with the surrounding aquifer, and the relative volumes of seepage in"ow over the CCS interfaces are shown in Figure 12. It is apparent from Figure 12 that most of the in"ow is across the East interface (i.e., the interface facing Biscayne Bay), most of the out"ow is across the Bottom interface, relatively lesser volume "uxes occur across of the North, South, and West interfaces, and in"ows and out-
"ows occur across all interfaces to varying degrees. The relative seepage contributions from the different faces are important inasmuch as the salinity in the aquifer adjacent to the East interface tends to be at least as high as the salinity in Biscayne Bay, the salinity in the aquifer adjacent to the Bottom interface tends to beonthesameorderofmagnitudeasthesalinityintheCCS,andlessersalinitiesoccurattheNorth,South, and West interfaces. The salt contributions from the CCS seepage interfaces are shown in Figure 13. It is apparent that the salt "uxes across the East and Bottom interfaces constitute the predominant components ofthesaltbudget,within"uxofsaltprimarilyassociatedwiththeEastinterfaceandef"uxofsaltprimarily associated with the Bottom interface; keeping in mind that both in"ux and ef"ux of salt can occur at these Exhibit 17
 
34
 
Figure12: SeepageintoCCSfromaquifer
 
interfaces. Lesserbutstillsigni"cantsaltin"uxoccursacrosstheSouthinterfaceandviaIDpumping,with much smaller to negligible salt "uxes across the North and West interfaces. It is apparent from Figure 13 thatintheintervalSeptember2013-May2014the"uxofsaltwasprimarilyand(almost)consistentlyinto the CCS from both the East and Bottom interfaces and, with relatively stable water level and volume in the CCS,thisyieldedan(almost)consistentincreaseintheCCSsalinityasdemonstratedbythemeasurements showninFigure14. Sincetheseepagein"uxwasdrivenbythede"citbetweenevaporationandrainfallvol-umes,itcanbeconcludedthattheincreaseinsalinityintheCCSwasduedirectlytotheevaporation-rainfall de"cit causing contemporaneous in"uxes of salinity from both the Bottom and East interfaces. Subsequent to the time period covered by Figure 14, salinity in the CCS during 2014 increased to a maximum daily-averagevalueofapproximately99.OnJanuary1,2015,theaveragesalinityintheCCSwas75,andby April 26, 2015, salinity levels were over 95. From April 27-28, 2015, signi"cant rainfall over the CCS reduced the average salinity to 78, however, salinities subsequently began rising again in the absence of morerainfall(SFWMD,2015).
 
Lessons learned. The results presented in this section clearly demonstrate that the salinity in the CCS can be expected to rise signi"cantly during prolonged periods without rainfall, and that further controls are necessary to ensure that CCS salinity concentrations do not exceed acceptable levels in the future. In October2015,inresponsetochloridelevelsintheBiscayneAquiferexceedingwater-qualitystandardsasa resultofthehighsalinitiesintheCCS,FPLreachedanagreementwithMiami-DadeCountywhichincludes construction and operation of six wells that would pump water from the CCS into the Boulder Zone of the FloridanAquifersoastoreducethesalinityintheCCS.
 
4 PumpingWaterfromtheL-31ECanalintotheCoolingCanals
 
4.1 PumpingPermitandProtocols InAugust2014,SFWMDissuedanEmergencyOrderauthorizingthepumpingofupto100mgdoffreshwa-terfromtheL-31ECanaltotheCCSbetweenAugustandOctober2014,withtheprimarygoalofreducing Exhibit 17
 
35
 
Figure13: Saltin"owtoCCS
 
the temperature in the CCS. Pursuant to this order, FPL conducted emergency pumping between Septem-ber25 and October15, 2014, and as a result the temperature in the CCS dropped by 6.5F, the salinity dropped from 87 to 75, and the algae concentrations reportedly dropped from 1315cell/L on Septem-ber 26, 2014 to 68cell/L on October 27, 2014. After pumping had terminated, algae concentrations again beganincreasing. Alsosubsequenttopumping,thetemperatureintheCCSbegantoriseagainandonApril 27, 2015, the intake temperature in the CCS was 98.2F. A large rainfall event between April 27 and 28, 2015reducedthetemperatureintheCCSto81.3F,however,byMay17,2015,theintaketemperaturehad risen to 94.6F, which was within 10F of the maximum allowable intake temperature of 104F. It was primarily on the basis of these conditions that FPL requested a permit to pump additional water from the L-31ECanalintotheCCS.
 
2015-2016 Pumping Permit In May 2015, FPL received a permit from the SFWMD to pump up to 100mgd from the L-31E Canal to the CCS, for the purpose of controlling the temperature in the CCS.
Pumping is permitted between June 1 and November 30 in both 2015 and 2016. A limitation stipulated within this permit is that water cannot be withdrawn from the L-31E Canal on any given day until at least 504acre-ft (2:2  10 7 ft3) of water has been diverted from the L-31E Canal to Biscayne Bay for purposes of"shandwildlifepreservation. DiversionofwaterfromtheL-31ECanaltoBiscayneBayoccursthrough structures S-20F, S-20G, and S-21A, which are located upstream of the CCS withdrawal location (at the SouthPumps)asshowninFigure15. Thesethreeupstreamstructuresopenandclosebasedonprescribed water-surface elevations in L-31E Canal at the structure locations, and the open/close stages of these struc-turesaregiveninTable3. Forexample,inthewet-seasonperiodofApril30-October15theS-20F,S-20G, and S-21A structures open when the L-31E Canal stage is at or above 0.67ft NAVD and close when the stage is at or below 0.27ft NAVD. The cumulative discharges from these structures are monitored daily, to ensure that no pumping from the L-31E Canal into the CCS is allowed until the cumulative discharges from these structures exceed the threshold of 504acre-ft. The delivery system consists of a northern and southernpumpstation,wherethenorthernpumpstationpumpswaterfromtheC-103BasinintotheL-31E Exhibit 17
 
36
 
Figure14: MeasuredandmodeledsalinityvariationsinCCS
 
Table3: GateOperationRulesthatAffectL-31EWithdrawals
 
L-31EStage Open Close Gate(s) Season Period (ftNAVD) (ftNAVD)
S-20F,S-20G,S-21A Wet April30-October15 0.67 0.27 S-20F Dry October15-April30 0.13 0.53 S-20G 0.67 0.27 S-21A 0.13 0.53
 
Canal, and the southern pump station pumps water from the L-31E Canal into the CCS. The operational plansynchronizesnorthernandsouthernpumpingoperationssoastoavertdewateringofwetlandsbetween the twopump stations and adjacent to the L-31E Canal. The operational protocol requires that the northern pumps always be started at least "ve minutes prior to starting the southern pumps, and at the end of each day the southern pumps must be shut down at least "ve minutes before the northern pumps are shut down.
This operational protocol for the pumps ensures that the volume of water pumped daily from the C-103 Basin into the L-31E Canal by the northern pumps exceeds the volume pumped from the L-31E Canal into the CCS by the southern pumps. A particularly important condition of the pumping permit is that FPL is requiredtomonitorthestageintheL-31ECanalbetweenthepumpstoensurethatthereisnodrawdownin the L-31E Canal as a result of the pumping operations. Besides ensuring that there is no L-31N drawdown as a result of pumping, this protocol also ensures that the wetlands adjacent to the L-31N Canal are not dewatered as a result of pumping. Subsequent to beginning of pumping on June 1 2015, the salinity level in the CCS dropped to 70, and subsequent large rainfall events have further reduced the CCS salinity to 60,accordingtoreportssubmittedbyFPLtotheSFWMD.
Exhibit 17
 
37
 
Figure15: PumpingfromL-31ECanalintoCooling-CanalSystem
 
4.2 QuantitativeEffects The change in temperature, T, of the water in the CCS resulting from the addition of a volumeV a water attemperatureT a canbeapproximatedusingtherelation
 
T = V aV 0 + V a (T a T 0) (9)
 
where V 0 is the initial volume of water in the CCS, and T 0 is the initial temperature of water in the CCS.
Equation9 is a very approximate relationship which assumes that the added water is well mixed over the CCS,anditneglectsthedifferencesindensityandspeci"cheatbetweenthesalinewaterintheCCSandthe freshwaterbeingadded. Inspiteoftheseshortcomingsandintheabsenceofadetailedheat-balancemodel of the CCS, Equation9 can be used to provide a rough estimate of how the temperature in the CCS might reacttotheadditionwaterfromtheL-31ECanal. If100mgd(=1:337  10 7 ft3/d)isaddedtotheCCSwhich hasavolumeof5:746  10 8 ft3 (assuminganaveragedepthof2.8ft)andtheaddedwaterhasatemperature of75F,thenEquation9canbeappliedusingadailytimesteptocalculatethetemperatureintheCCSinas a function of number of days of continuous pumping for initial temperatures in the range of 85F-100F.
The results of these calculations are shown in Figure 16(a). In a similar manner, the change in salinity, S, in the CCS resulting from the addition water at salinity S a can be estimated using the approximate relationship S = (V a V e)V 0 + (V a V e) (S a S 0) (10)
 
whereS 0 is the initial salinity in the CCS, andV e is the evaporated volume. Equation10 is an approximate relationship which assumes that the added water is well mixed over the CCS, and it neglects decreases in salinity that would be caused by rainfall. If 100mgd is added to the CCS and the rate of evaporation is 39mgd, then the net rate of freshwater addition to the CCS (i.e., V a V e) is equal to 61mgd (= 8:156 
10 6 ft3/d). Using the same CCS volumeV 0 that is used for calculating the daily temperature changes, T,
Exhibit 17
 
38
 
Figure16: Approximateeffectofpumping100mgdontemperatureandsalinityinCCS
 
and taking the salinity, S a of the water pumped from the L-31E Canal equal to zero, Equation 10 can be used to calculate the salinity in the CCS in as a function of number of days of continuous pumping for initialsalinitiesintherangeof70-100asshowninFigure16(b). TheresultsinFigure16collectively indicate that the sustained addition of 100mgd from the L-31E Canal to the CCS over continuous times on the order of a week to a month (30 days) would be an effective means of reducing the temperature and salinity in the CCS. The environmental effects on the surrounding environment of pumping water from the L-31ECanaltotheCCSarediscussedsubsequently.
 
Context. Toputavolume"owrateof100mgdoffreshwaterinasocietalcontext,itisnotedthat100mgd isapproximatelytheaveragedailydrinking-waterdemandofonemillionpeople. InthecontextoftheCCS, 100mgdcanbecontrastedwiththeaverageCCSevaporationrateofaround39mgdandalong-termaverage rainfall rate on the CCS of around 21mgd, where both of these averages are computed over the 9/1/2010-5/1/2014timeperiod. IftheCCSwereemptyandweretobe"lledbysupplyingwaterat100mgd,itwould take approximately 43days to "ll the CCS. Although 100mgd is more than twice the evaporation rate, the coolingeffectofaunitvolumeofevaporatedwaterismuchgreaterthanthecoolingeffectofaunitvolume ofaddedliquidwater. Forexample, aunitvolumeofevaporatedwaterwouldcauseatemperaturedecrease of around 50 times the temperature decrease caused by adding a unit volume of liquid water that is 20F cooler than the CCS. Therefore, in thermodynamic terms, the addition of 100mgd of pumped water has approximately the same cooling effect as 2mgd of evaporated water. With regard to salinity, the salinity reduction resulting from the addition of a unit volume of fresh water exactly compensates for the salinity increase caused by a unit volume of evaporated water. Hence, 39mgd of added water would neutralize the salinity-increasecausedby39mgdofevaporatedwater,withtheexcessaddedwatercausingareductionin salinity.
 
4.3 ModelResults The water-balance and salt-balance models used previously by FPL to simulate the pre-uprate salinity dy-namicsintheCCSwereusedbyFPLtosimulatethepotentialfuturescenarioswithandwithouttheL-31E waterinputsinthesummerof2015and2016. FPLmademinorrevisionsinthemodeltoincorporatedataup throughOctober2014. ThemodelsimulationtopredicttheresponseoftheCCStopumpingwaterfromthe Exhibit 17
 
39
 
L-31E Canal started November 1, 2014, and ended November 30, 2016. Two scenarios were simulated at multiplemaximum-allowablewithdrawalrates,whereactualwithdrawalrateswerepredicatedontheavail-ability of water in the L-31E Canal after providing 504acre-ft to Biscayne Bay. Scenario A assumes future conditionsthatarethesameasthoseobservedbetweenNovemberl,2010andOctober31,2012;conditions during this time frame re"ected normal weather patterns. Scenario B assumes future conditions that are the same as those observed between November 1, 2013 and October 31, 2014; conditions during this time re"ected dry weather patterns, and this one-year period was repeated sequentially to produce a two-year predictive simulation. In both scenarios, the conditions observed during the "rst November (2010, 2013) wererepeatedtosimulateconditionsforthelastmonth(November2016)ofthe25-monthpredictivesimu-lation. ScenarioAandScenarioBwereeachrunfourtimesunderdifferentpumpingscenarios: nopumping, 30mgd-maximum, 60mgd-maximum, and 100mgd-maximum and for a two-year time period. Under all pumping scenarios the simulated CCS water levels increased and simulated CCS salinities decreased rela-tive to the base case of no pumping. Greater changes were observed in response to greater pumping rates.
Underallpumpingscenarios,thegreatestincreasesinCCSstageoccurbetweenJune1andNovember30.
 
Applicationof modelresults. The water-balance and salinity-balance modeling done by FPL in support oftheapplicationforthe2015-2016pumpingpermitfocusedontheeffectivenessoftheL-31Epumpingon reducing salinity, whereas the primary motivation for pumping from the L-31E Canal is actually to reduce temperature. Elevated temperatures in the CCS will affect power-generation while elevated salinities will not,andthereisnotaproportionalcorrespondencebetweenreducedsalinityandreducedtemperature,since temperaturesintheCCSdependonavarietyofotherfactorsbesidesthevolumeofwaterpumpedfromthe L-31ECanal..
 
4.4 EnvironmentalEffects Environmentalconcernsthathavebeenraisedpreviouslybyothersrelatetoboththediversionoffreshwater fromotherenvironmentalrestorationprojectsthatarecurrentlybeingservicedbytheL-31ECanal,andthe utilizationoffreshwatertodilutehypersalinewater,whichdegradesthequalityandutilityofthefreshwa-ter. Based on available information, it appears that the only environmental projects currently being served directlybytheL-31ECanalistheBiscayneBay"shandwildlifepreservationallocationof504acre-ft,and the maintenance seasonal water levels in support of adjacent wetlands. The permitted pumping operation will not divert the water volume previously allocated to "sh and wildlife preservation, and a pumping pro-tocol will be followed to maintain water levels at their no-pumping levels. With respect to the degradation of fresh water, this degradation will in fact occur, however, the extent of water-quality deterioration and speci"c deleterious impacts on existing water uses have not to date been identi"ed. Aside from these pre-viously raised concerns, some major additional concerns resulting from pumping up to 100mgd from the L-31ECanaltotheCCSaredescribedbelow.
 
4.4.1 EffectofIncreasedWater-SurfaceElevationsintheCCS Pumping water from the L-31E Canal into the CCS will elevate the average water level in the CCS relative to the water level that would exist without pumping. The magnitudes of water-level increases in the CCS were estimated by FPL using the previously developed and calibrated mass balance model of the CCS, and theresultsofthesesimulationsweresubmittedtotheSFWMDaspartoftheapplicationforthe2015-2016 pumping permit (SFWMD, 2015). Since the water level in the L-31E Canal will be held constant during Exhibit 17
 
40
 
pumping operations, the increased water-surface elevations in the CCS are of concern because they will decrease the seaward piezometric-head gradient between the L-31E Canal and the CCS. Furthermore, it is likely that the piezometric-head gradient between the L-31E Canal and the CCS could be reversed from a seaward gradient to a landward gradient. This could produce landward groundwater "ow between the CCS andtheL-31ECanal,whichwouldlikelyadvectasalineplumefromtheCCStowardstheL-31ECanal. In additiontotheaforementionedoutcome,elevatedwaterlevelsintheCCSresultingfrompumping100mgd fromtheL-31ECanalwillincreasethe(seaward)piezometric-headgradientbetweentheCCSandBiscayne Bay,resultingintheincreaseddischargeofhigher-salinitywaterfromtheCCSintotheBayviatheBiscayne Aquifer.
 
Relevantdata. Toquantifytheeffectofincreasedwater-surfaceelevationsintheCCSthatwouldoccuras aresultofpumping,theincreasedwater-surfaceelevationssimulatedbyFPLweresubtractedfromhistorical water-level differences between the L-31E Canal and the CCS to yield possible water-level differences un-derthe100-mgdpumpingscenario. Asdescribedpreviously,twoscenariosweremodeled,withScenarioA corresponding to normal conditions and ScenarioB corresponding to dry conditions. Each simulation coveredtwoyears(2015and2016),withpumpingineachyearfromJune1toNovember30. Theincreases inCCSwater-surfaceelevationsoverthewater-surfaceelevationsthatwouldexistintheCCSwithoutpump-ing are given in Table 4 for selected dates (about a month apart) during each of these scenarios. The values
 
Table4: EstimatedWaterLevelIncreasesinCCS
 
2015 2016 Day-Month Scenario (ft) (ft) 15-Jun A 0.00 0.23 15-Jul A 0.00 0.55 15-Aug A 0.55 0.40 15-Sep A 0.57 0.40 15-Oct A 0.50 0.60 15-Nov A 0.65 0.60 30-Nov A 0.50 0.45
 
15-Jun B 0.00 0.00 15-Jul B 0.62 0.50 15-Aug B 0.65 0.70 15-Sep B 0.15 0.10 15-Oct B 0.35 0.30 15-Nov B 0.37 0.55 30-Nov B 0.50 0.65
 
giveninTable4wereestimatedfromgraphicalplotsdevelopedbyFPLaspartofthepermitapplication. It is apparent from Table 4 that water-level increases in the CCS on the order of 0.5ft are predicted to occur as a result of pumping water at a rate of 100mgd from the L-31E Canal into the CCS. These water-level increases can be contrasted with historical differences in the water levels between the L-31E Canal and the CCS for the pre-uprate (June 2011-May 2012) and post-uprate (June 2013-May 2014) periods as shown in Table 5, where a positive difference indicates that the water level in the L-31E Canal is higher than the Exhibit 17
 
41
 
water level in the CCS. It is apparent from Table 5 that the historical differences between the water levels
 
Table5: HistoricalWater-LevelDifferencesBetweenL-31ECanalandCCS
 
Pre-Uprate Post-Uprate Day-Month (ft) (ft) 15-Jun 0.32 0.46 15-Jul 0.57 0.37 15-Aug 0.80 0.40 15-Sep 0.42 0.48 15-Oct 0.85 0.60 15-Nov 0.51 0.49 30-Nov 0.55 0.45
 
in the L-31E Canal and the CCS are typically on the same order of magnitude as the expected increases in the CCS water level, and therefore a signi"cant impact on the historical seaward water-level gradient is to be expected. This concern is further ampli"ed when it is considered that a minimum water-level difference of 0.30ft is required to keep an acceptable seaward water-level gradient and to keep from triggering the interceptorditch(ID)pumps. IftheIDpumpsareturnedon,thiswouldfurtherelevatethewaterlevelinthe CCSandfurtherdecreasethewater-leveldifferencebetweentheL-31ECanalandtheCCS.
 
Demonstrationofeffects. Theincreasesinthewater-surfaceelevationsintheCCSpredictedbytheFPL mass-balance model can be subtracted from the historical water-level differences between the L-31E Canal and the CCS to estimate the water-level differences between the L-31E Canal and the CCS that are likely to exist as a consequence of pumping a maximum of 100mgd from the L-31E Canal into the CCS. These expectedwater-leveldifferencesaresummarizedfortheScenarioA(thenormalcondition)inFigure17(a),
and for ScenarioB (the dry condition) in Figure 17(b). For each historical period (pre-uprate and post-uprate), and for each selected day, three water-level differences are shown: the historical difference (blue),
the projected 2015 difference (orange), and the projected 2016 difference (gray). In general, the 2015 and 2016 projected water-level differences are less than the historical differences by the amounts listed in Table 4. Also shown in Figure 17 is the 0.30-ft reference line, which is the threshold water-level difference belowwhichtheIDpumpsystemistriggered. ItisapparentfromFigure17(a)thatunderpre-upratewater-level-differenceconditionsalandwardwater-levelgradientwouldbecreatedaround15-Sepand15-Novon whichdatestherewerepreviouslyseawardwater-levelgradients;the15-Jundatapointisanomalousinthata landwardgradientalreadyexistedinthehistoricalrecord. ItisfurtherapparentfromFigure17(a)thatunder post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov on which dates there were previously seaward gradients. Under bothhistoricalconditions(pre-uprate, post-uprate)showninFigure17(a), thedifferencebetweenthewater level in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all of the dates cited in Figure17(a). ConsideringScenarioB(thedrycondition)showninFigure17(b),theresultsaresimilarto thoseshowninFigure17(a). Underpre-uprateconditions,alandwardwater-levelgradientwouldbecreated around 15-Sep and 15-Nov, and under post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov. Under both historical conditions, the difference between the water levels in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all dates cited in Figure 17(b). The results shown in Figure 17 collectively show that Exhibit 17


Exhibit 17 33 3.2.4 Demonstration of Salinity Dynamics The mechanism driving salinity changes in the CCS can be demonstrated using the previously calibrated salinity model. The cumulative rainfall, evaporation, seepage inflow, ID pumpage, and water storage (= net inflow) within the CCS between September 2010 and April 2014 are shown in Figure 11. It is apparent 4
42
Cumulave in"ow to CCS (x 1010 gallons)
ID pumpage 3
Rainfall                        Seepage 2
1 0
1 Net in"ow 2
3 Evaporaon 4
5 6
Sep-10  Dec-10  Mar-11  Jun-11  Sep-11  Dec-11  Mar-12  Jun-12  Sep-12  Dec-12  Mar-13  Jun-13  Sep-13  Dec-13  Mar-13  Jun-14 Figure 11: Water inflow into CCS from Figure 11 that the storage in the CCS remains relatively constant compared with cumulative rainfall, evaporation, ID pumpage, and seepage inflow. Further, it can be asserted from Figure 11 that the seepage inflow adjusts to the difference between evaporation and rainfall-plus-ID-pumpage so as to keep the volume of water within the CCS approximately constant. The cumulative evaporation and rainfall in Figure 11 show approximately linear trends, with the evaporation trend line showing an average evaporation rate of approximately 39 mgd, and the rainfall trend line showing an average rainfall rate of approximately 21 mgd.
Distribution of seepage inflows and outflows. Seepage flow to the CCS does not occur uniformly over the interfaces of the CCS with the surrounding aquifer, and the relative volumes of seepage inflow over the CCS interfaces are shown in Figure 12. It is apparent from Figure 12 that most of the inflow is across the East interface (i.e., the interface facing Biscayne Bay), most of the outflow is across the Bottom interface, relatively lesser volume fluxes occur across of the North, South, and West interfaces, and inflows and out-flows occur across all interfaces to varying degrees. The relative seepage contributions from the different faces are important inasmuch as the salinity in the aquifer adjacent to the East interface tends to be at least as high as the salinity in Biscayne Bay, the salinity in the aquifer adjacent to the Bottom interface tends to be on the same order of magnitude as the salinity in the CCS, and lesser salinities occur at the North, South, and West interfaces. The salt contributions from the CCS seepage interfaces are shown in Figure 13. It is apparent that the salt fluxes across the East and Bottom interfaces constitute the predominant components of the salt budget, with influx of salt primarily associated with the East interface and efflux of salt primarily associated with the Bottom interface; keeping in mind that both influx and efflux of salt can occur at these


Exhibit 17 34 2.0 Seepage in"ow to CCS (x 1010 gallons) 1.5 1.0 East 0.5 South                  West              North 0
Figure 17: Differences Between L-31E Canal and CCS Water Levels. The historical difference is in blue, theprojected2015differenceisinorange,andtheprojected2016differenceisingray.
0.5 Bo!om 1.0 Sep-10  Dec-10  Mar-11  Jun-11  Sep-11  Dec-11  Mar-12  Jun-12  Sep-12  Dec-12  Mar-13  Jun-13  Sep-13  Dec-13  Mar-13  Jun-14 Figure 12: Seepage into CCS from aquifer interfaces. Lesser but still significant salt influx occurs across the South interface and via ID pumping, with much smaller to negligible salt fluxes across the North and West interfaces. It is apparent from Figure 13 that in the interval September 2013 - May 2014 the flux of salt was primarily and (almost) consistently into the CCS from both the East and Bottom interfaces and, with relatively stable water level and volume in the CCS, this yielded an (almost) consistent increase in the CCS salinity as demonstrated by the measurements shown in Figure 14. Since the seepage influx was driven by the deficit between evaporation and rainfall vol-umes, it can be concluded that the increase in salinity in the CCS was due directly to the evaporation-rainfall deficit causing contemporaneous influxes of salinity from both the Bottom and East interfaces. Subsequent to the time period covered by Figure 14, salinity in the CCS during 2014 increased to a maximum daily-average value of approximately 99. On January 1, 2015, the average salinity in the CCS was 75, and by April 26, 2015, salinity levels were over 95. From April 27 - 28, 2015, significant rainfall over the CCS reduced the average salinity to 78, however, salinities subsequently began rising again in the absence of more rainfall (SFWMD, 2015).
Lessons learned. The results presented in this section clearly demonstrate that the salinity in the CCS can be expected to rise significantly during prolonged periods without rainfall, and that further controls are necessary to ensure that CCS salinity concentrations do not exceed acceptable levels in the future. In October 2015, in response to chloride levels in the Biscayne Aquifer exceeding water-quality standards as a result of the high salinities in the CCS, FPL reached an agreement with Miami-Dade County which includes construction and operation of six wells that would pump water from the CCS into the Boulder Zone of the Floridan Aquifer so as to reduce the salinity in the CCS.
4    Pumping Water from the L-31E Canal into the Cooling Canals 4.1  Pumping Permit and Protocols In August 2014, SFWMD issued an Emergency Order authorizing the pumping of up to 100 mgd of freshwa-ter from the L-31E Canal to the CCS between August and October 2014, with the primary goal of reducing


Exhibit 17 35 4
thereiscauseforconcernthatpumping100mgdfromtheL-31ECanalintotheCCScouldcausealandward water-level gradient where none previously existed. This concern is further exacerbated when considering that water levels at the northern end of the CCS near the discharge from the power-generating units will be higher that the average water level in the CCS that is used in this analysis, which further decreases the seawardwater-levelgradientbetweentheL-31ECanalandtheCCS.Concernisfurtherheightenedwhenthe increased density of water in (and under) the CCS is taken into account, since the difference in equivalent freshwater (piezometric) heads between the L-31E Canal and the CCS is less that the difference in water levels between the L-31E Canal and the CCS. It is actually the difference in equivalent freshwater heads that govern the "ow between these bodies of water (e.g., Post et al., 2007). This latter point is particularly importantsincethedifferenceinfreshwaterheadsbetweentheL-31ECanalandtheCCSwillincreasewith depth.
Cumula!ve salt in"ow to CCS (x 109 lb) 3 East 2
North West 1                                        South ID 0
1 Net 2
3 Bo$om 4
5 Dec-10 Sep-10  Mar-11 Jun-11  Sep-11    Dec-11  Mar-12  Jun-12  Sep-12  Dec-12  Mar-13  Jun-13  Sep-13  Dec-13  Mar-13  Jun-14 Figure 13: Salt inflow to CCS the temperature in the CCS. Pursuant to this order, FPL conducted emergency pumping between Septem-ber 25 and October 15, 2014, and as a result the temperature in the CCS dropped by 6.5 F, the salinity dropped from 87 to 75, and the algae concentrations reportedly dropped from 1315 cell/L on Septem-ber 26, 2014 to 68 cell/L on October 27, 2014. After pumping had terminated, algae concentrations again began increasing. Also subsequent to pumping, the temperature in the CCS began to rise again and on April 27, 2015, the intake temperature in the CCS was 98.2 F. A large rainfall event between April 27 and 28, 2015 reduced the temperature in the CCS to 81.3 F, however, by May 17, 2015, the intake temperature had risen to 94.6 F, which was within 10 F of the maximum allowable intake temperature of 104 F. It was primarily on the basis of these conditions that FPL requested a permit to pump additional water from the L-31E Canal into the CCS.
2015 - 2016 Pumping Permit In May 2015, FPL received a permit from the SFWMD to pump up to 100 mgd from the L-31E Canal to the CCS, for the purpose of controlling the temperature in the CCS.
Pumping is permitted between June 1 and November 30 in both 2015 and 2016. A limitation stipulated within this permit is that water cannot be withdrawn from the L-31E Canal on any given day until at least 504 acre-ft (2.2 x 107 ft3 ) of water has been diverted from the L-31E Canal to Biscayne Bay for purposes of fish and wildlife preservation. Diversion of water from the L-31E Canal to Biscayne Bay occurs through structures S-20F, S-20G, and S-21A, which are located upstream of the CCS withdrawal location (at the South Pumps) as shown in Figure 15. These three upstream structures open and close based on prescribed water-surface elevations in L-31E Canal at the structure locations, and the open/close stages of these struc-tures are given in Table 3. For example, in the wet-season period of April 30 - October 15 the S-20F, S-20G, and S-21A structures open when the L-31E Canal stage is at or above 0.67 ft NAVD and close when the stage is at or below 0.27 ft NAVD. The cumulative discharges from these structures are monitored daily, to ensure that no pumping from the L-31E Canal into the CCS is allowed until the cumulative discharges from these structures exceed the threshold of 504 acre-ft. The delivery system consists of a northern and southern pump station, where the northern pump station pumps water from the C-103 Basin into the L-31E


Exhibit 17 36 100 90 80 CCS Salinity ()
Effectofgeneratingalandwardgradient. Alandwardgradientinthefreshwater-equivalentpiezometric head between the L-31E Canal and the CCS would advect saline water from the CCS towards the L-31E Canal. Such gradients are likely to be generated under 100-mgd pumping operations. Also, since pumping Exhibit 17
Modeled Measured 70 60 50 40 30 Sep-10  Feb-11    Jul-11  Dec-11  May-12  Oct-12  Mar-13  Aug-13    Jan-13  May-14 Figure 14: Measured and modeled salinity variations in CCS Table 3: Gate Operation Rules that Affect L-31E Withdrawals L-31E Stage Open      Close Gate(s)                                          Season        Period                          (ft NAVD) (ft NAVD)
S-20F, S-20G, S-21A                              Wet            April 30 - October 15                    0.67                0.27 S-20F                                            Dry            October 15 - April 30                  0.13              0.53 S-20G                                                                                                    0.67                0.27 S-21A                                                                                                  0.13              0.53 Canal, and the southern pump station pumps water from the L-31E Canal into the CCS. The operational plan synchronizes northern and southern pumping operations so as to avert dewatering of wetlands between the two pump stations and adjacent to the L-31E Canal. The operational protocol requires that the northern pumps always be started at least five minutes prior to starting the southern pumps, and at the end of each day the southern pumps must be shut down at least five minutes before the northern pumps are shut down.
This operational protocol for the pumps ensures that the volume of water pumped daily from the C-103 Basin into the L-31E Canal by the northern pumps exceeds the volume pumped from the L-31E Canal into the CCS by the southern pumps. A particularly important condition of the pumping permit is that FPL is required to monitor the stage in the L-31E Canal between the pumps to ensure that there is no drawdown in the L-31E Canal as a result of the pumping operations. Besides ensuring that there is no L-31N drawdown as a result of pumping, this protocol also ensures that the wetlands adjacent to the L-31N Canal are not dewatered as a result of pumping. Subsequent to beginning of pumping on June 1 2015, the salinity level in the CCS dropped to 70, and subsequent large rainfall events have further reduced the CCS salinity to 60, according to reports submitted by FPL to the SFWMD.


Exhibit 17 37 S-21A S-20G C-103 Canal S-21F North Pumps L-31E Canal South Pumps Cooling Canals Figure 15: Pumping from L-31E Canal into Cooling-Canal System 4.2    Quantitative Effects The change in temperature, T , of the water in the CCS resulting from the addition of a volume Va water at temperature Ta can be approximated using the relation Va T =                (Ta  T0 )                                  (9)
43
V0 + Va where V0 is the initial volume of water in the CCS, and T0 is the initial temperature of water in the CCS.
Equation 9 is a very approximate relationship which assumes that the added water is well mixed over the CCS, and it neglects the differences in density and specific heat between the saline water in the CCS and the fresh water being added. In spite of these shortcomings and in the absence of a detailed heat-balance model of the CCS, Equation 9 can be used to provide a rough estimate of how the temperature in the CCS might react to the addition water from the L-31E Canal. If 100 mgd (= 1.337x107 ft3 /d) is added to the CCS which has a volume of 5.746 x 108 ft3 (assuming an average depth of 2.8 ft) and the added water has a temperature of 75 F, then Equation 9 can be applied using a daily time step to calculate the temperature in the CCS in as a function of number of days of continuous pumping for initial temperatures in the range of 85 F - 100 F.
The results of these calculations are shown in Figure 16(a). In a similar manner, the change in salinity, S, in the CCS resulting from the addition water at salinity Sa can be estimated using the approximate relationship (Va  Ve )
S =                    (Sa  S0 )                              (10)
V0 + (Va  Ve )
where S0 is the initial salinity in the CCS, and Ve is the evaporated volume. Equation 10 is an approximate relationship which assumes that the added water is well mixed over the CCS, and it neglects decreases in salinity that would be caused by rainfall. If 100 mgd is added to the CCS and the rate of evaporation is 39 mgd, then the net rate of freshwater addition to the CCS (i.e., Va  Ve ) is equal to 61 mgd (= 8.156 x 106 ft3 /d). Using the same CCS volume V0 that is used for calculating the daily temperature changes, T ,


Exhibit 17 38 100                                                                    100 CCS temperature (oF) o Ti = 100 F                                                        Si = 100 80 CCS salinity (")
would be occurring mostly during the wet season, it is likely that a seaward head gradient would exist (and be maintained) west of the L-31E Canal. As a consequence of a landward gradient in the freshwater-equivalent piezometric head east of the L-31E Canal and a seaward (freshwater) head gradient west of the L-31E Canal, it is possible that a saline circulation cell is developed in which water is pumped from the L-31E Canal into the CCS, water seeps out of the CCS and "ows through the Biscayne Aquifer back into theL-31ECanal,andthenthiswaterispumpedbackintotheCCS.Thiscirculationcellwouldincreasethe salinity in the L-31E Canal, which would degrade the quality of the water in the L-31E Canal and decrease theeffectivenessofthepumpedwaterindecreasingthesalinityintheCCS.
95 Ti = 95oF                                                        Si = 95 90                                    Ti = 90oF                        60                              Si = 90 Ti = 85oF                        40                              Si = 85 85 80                                                                      20 75                                                                      0 0          50      100      150        200                          0      50      100      150        200 Time a!er pumping begins (days)                                  Time a!er pumping begins (days)
(a) Temperature versus pumping #me                                    (b) Salinity versus pumping #me Figure 16: Approximate effect of pumping 100 mgd on temperature and salinity in CCS and taking the salinity, Sa of the water pumped from the L-31E Canal equal to zero, Equation 10 can be used to calculate the salinity in the CCS in as a function of number of days of continuous pumping for initial salinities in the range of 70 - 100 as shown in Figure 16(b). The results in Figure 16 collectively indicate that the sustained addition of 100 mgd from the L-31E Canal to the CCS over continuous times on the order of a week to a month (30 days) would be an effective means of reducing the temperature and salinity in the CCS. The environmental effects on the surrounding environment of pumping water from the L-31E Canal to the CCS are discussed subsequently.
Context. To put a volume flow rate of 100 mgd of fresh water in a societal context, it is noted that 100 mgd is approximately the average daily drinking-water demand of one million people. In the context of the CCS, 100 mgd can be contrasted with the average CCS evaporation rate of around 39 mgd and a long-term average rainfall rate on the CCS of around 21 mgd, where both of these averages are computed over the 9/1/2010 -
5/1/2014 time period. If the CCS were empty and were to be filled by supplying water at 100 mgd, it would take approximately 43 days to fill the CCS. Although 100 mgd is more than twice the evaporation rate, the cooling effect of a unit volume of evaporated water is much greater than the cooling effect of a unit volume of added liquid water. For example, a unit volume of evaporated water would cause a temperature decrease of around 50 times the temperature decrease caused by adding a unit volume of liquid water that is 20 F cooler than the CCS. Therefore, in thermodynamic terms, the addition of 100 mgd of pumped water has approximately the same cooling effect as 2 mgd of evaporated water. With regard to salinity, the salinity reduction resulting from the addition of a unit volume of fresh water exactly compensates for the salinity increase caused by a unit volume of evaporated water. Hence, 39 mgd of added water would neutralize the salinity-increase caused by 39 mgd of evaporated water, with the excess added water causing a reduction in salinity.
4.3 Model Results The water-balance and salt-balance models used previously by FPL to simulate the pre-uprate salinity dy-namics in the CCS were used by FPL to simulate the potential future scenarios with and without the L-31E water inputs in the summer of 2015 and 2016. FPL made minor revisions in the model to incorporate data up through October 2014. The model simulation to predict the response of the CCS to pumping water from the


Exhibit 17 39 L-31E Canal started November 1, 2014, and ended November 30, 2016. Two scenarios were simulated at multiple maximum-allowable withdrawal rates, where actual withdrawal rates were predicated on the avail-ability of water in the L-31E Canal after providing 504 acre-ft to Biscayne Bay. Scenario A assumes future conditions that are the same as those observed between November l, 2010 and October 31, 2012; conditions during this time frame reflected normal weather patterns. Scenario B assumes future conditions that are the same as those observed between November 1, 2013 and October 31, 2014; conditions during this time reflected dry weather patterns, and this one-year period was repeated sequentially to produce a two-year predictive simulation. In both scenarios, the conditions observed during the first November (2010, 2013) were repeated to simulate conditions for the last month (November 2016) of the 25-month predictive simu-lation. Scenario A and Scenario B were each run four times under different pumping scenarios: no pumping, 30 mgd-maximum, 60 mgd-maximum, and 100 mgd-maximum and for a two-year time period. Under all pumping scenarios the simulated CCS water levels increased and simulated CCS salinities decreased rela-tive to the base case of no pumping. Greater changes were observed in response to greater pumping rates.
Historical anecdote. Interestingly, in 1978, engineers from the consulting "rm Dames and Moore wrote a report to FPL with a speci"c section in their report titled Effects of an Overall Increase in Water Level in the Cooling-Canal System Relative to the Ground Water (Dames and Moore, 1978). In their report, the engineers at Dames and Moore speci"cally considered the impact of raising the water level in the CCS by 0.50ft above the water table in the surrounding aquifer. They concluded that such an occurrence would cause the saltwater interface to move approximately one mile further inland relative to its location prior to theriseinthewaterleveloftheCCS.
Under all pumping scenarios, the greatest increases in CCS stage occur between June 1 and November 30.
Application of model results. The water-balance and salinity-balance modeling done by FPL in support of the application for the 2015 - 2016 pumping permit focused on the effectiveness of the L-31E pumping on reducing salinity, whereas the primary motivation for pumping from the L-31E Canal is actually to reduce temperature. Elevated temperatures in the CCS will affect power-generation while elevated salinities will not, and there is not a proportional correspondence between reduced salinity and reduced temperature, since temperatures in the CCS depend on a variety of other factors besides the volume of water pumped from the L-31E Canal..
4.4    Environmental Effects Environmental concerns that have been raised previously by others relate to both the diversion of fresh water from other environmental restoration projects that are currently being serviced by the L-31E Canal, and the utilization of fresh water to dilute hypersaline water, which degrades the quality and utility of the fresh wa-ter. Based on available information, it appears that the only environmental projects currently being served directly by the L-31E Canal is the Biscayne Bay fish and wildlife preservation allocation of 504 acre-ft, and the maintenance seasonal water levels in support of adjacent wetlands. The permitted pumping operation will not divert the water volume previously allocated to fish and wildlife preservation, and a pumping pro-tocol will be followed to maintain water levels at their no-pumping levels. With respect to the degradation of fresh water, this degradation will in fact occur, however, the extent of water-quality deterioration and specific deleterious impacts on existing water uses have not to date been identified. Aside from these pre-viously raised concerns, some major additional concerns resulting from pumping up to 100 mgd from the L-31E Canal to the CCS are described below.
4.4.1 Effect of Increased Water-Surface Elevations in the CCS Pumping water from the L-31E Canal into the CCS will elevate the average water level in the CCS relative to the water level that would exist without pumping. The magnitudes of water-level increases in the CCS were estimated by FPL using the previously developed and calibrated mass balance model of the CCS, and the results of these simulations were submitted to the SFWMD as part of the application for the 2015 - 2016 pumping permit (SFWMD, 2015). Since the water level in the L-31E Canal will be held constant during


Exhibit 17 40 pumping operations, the increased water-surface elevations in the CCS are of concern because they will decrease the seaward piezometric-head gradient between the L-31E Canal and the CCS. Furthermore, it is likely that the piezometric-head gradient between the L-31E Canal and the CCS could be reversed from a seaward gradient to a landward gradient. This could produce landward groundwater flow between the CCS and the L-31E Canal, which would likely advect a saline plume from the CCS towards the L-31E Canal. In addition to the aforementioned outcome, elevated water levels in the CCS resulting from pumping 100 mgd from the L-31E Canal will increase the (seaward) piezometric-head gradient between the CCS and Biscayne Bay, resulting in the increased discharge of higher-salinity water from the CCS into the Bay via the Biscayne Aquifer.
4.4.2 SuggestedPermitModi"cations Based on the concerns described here, along with the supporting analyses provided, it is recommended that the pump-operation protocol associated with the 2015-2016 pumping permit be modi"ed to include measurement of water levels in the CCS, and that a threshold water-level difference between the L-31E Canal and the CCS be determined by the SFWMD and added as a controlling factor in pump operations.
Relevant data. To quantify the effect of increased water-surface elevations in the CCS that would occur as a result of pumping, the increased water-surface elevations simulated by FPL were subtracted from historical water-level differences between the L-31E Canal and the CCS to yield possible water-level differences un-der the 100-mgd pumping scenario. As described previously, two scenarios were modeled, with Scenario A corresponding to normal conditions and Scenario B corresponding to dry conditions. Each simulation covered two years (2015 and 2016), with pumping in each year from June 1 to November 30. The increases in CCS water-surface elevations over the water-surface elevations that would exist in the CCS without pump-ing are given in Table 4 for selected dates (about a month apart) during each of these scenarios. The values Table 4: Estimated Water Level Increases in CCS 2015    2016 Day-Month      Scenario      (ft)    (ft) 15-Jun            A        0.00    0.23 15-Jul            A        0.00    0.55 15-Aug            A        0.55    0.40 15-Sep            A        0.57    0.40 15-Oct            A        0.50    0.60 15-Nov            A        0.65    0.60 30-Nov            A        0.50    0.45 15-Jun            B        0.00    0.00 15-Jul            B        0.62    0.50 15-Aug            B        0.65    0.70 15-Sep            B        0.15    0.10 15-Oct            B        0.35    0.30 15-Nov            B        0.37    0.55 30-Nov            B        0.50    0.65 given in Table 4 were estimated from graphical plots developed by FPL as part of the permit application. It is apparent from Table 4 that water-level increases in the CCS on the order of 0.5 ft are predicted to occur as a result of pumping water at a rate of 100 mgd from the L-31E Canal into the CCS. These water-level increases can be contrasted with historical differences in the water levels between the L-31E Canal and the CCS for the pre-uprate (June 2011 - May 2012) and post-uprate (June 2013 - May 2014) periods as shown in Table 5, where a positive difference indicates that the water level in the L-31E Canal is higher than the
To ensure that a subsurface circulation cell of saline water does not develop, the salinity of the water in the L-31ECanalshouldbemonitoredduringpumpoperations.


Exhibit 17 41 water level in the CCS. It is apparent from Table 5 that the historical differences between the water levels Table 5: Historical Water-Level Differences Between L-31E Canal and CCS Pre-Uprate      Post-Uprate Day-Month          (ft)            (ft) 15-Jun            0.32            0.46 15-Jul              0.57            0.37 15-Aug              0.80            0.40 15-Sep              0.42            0.48 15-Oct              0.85            0.60 15-Nov              0.51            0.49 30-Nov              0.55            0.45 in the L-31E Canal and the CCS are typically on the same order of magnitude as the expected increases in the CCS water level, and therefore a significant impact on the historical seaward water-level gradient is to be expected. This concern is further amplified when it is considered that a minimum water-level difference of 0.30 ft is required to keep an acceptable seaward water-level gradient and to keep from triggering the interceptor ditch (ID) pumps. If the ID pumps are turned on, this would further elevate the water level in the CCS and further decrease the water-level difference between the L-31E Canal and the CCS.
5 ConclusionsandRecommendations
Demonstration of effects. The increases in the water-surface elevations in the CCS predicted by the FPL mass-balance model can be subtracted from the historical water-level differences between the L-31E Canal and the CCS to estimate the water-level differences between the L-31E Canal and the CCS that are likely to exist as a consequence of pumping a maximum of 100 mgd from the L-31E Canal into the CCS. These expected water-level differences are summarized for the Scenario A (the normal condition) in Figure 17(a),
and for Scenario B (the dry condition) in Figure 17(b). For each historical period (pre-uprate and post-uprate), and for each selected day, three water-level differences are shown: the historical difference (blue),
the projected 2015 difference (orange), and the projected 2016 difference (gray). In general, the 2015 and 2016 projected water-level differences are less than the historical differences by the amounts listed in Table 4. Also shown in Figure 17 is the 0.30-ft reference line, which is the threshold water-level difference below which the ID pump system is triggered. It is apparent from Figure 17(a) that under pre-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Sep and 15-Nov on which dates there were previously seaward water-level gradients; the 15-Jun data point is anomalous in that a landward gradient already existed in the historical record. It is further apparent from Figure 17(a) that under post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov on which dates there were previously seaward gradients. Under both historical conditions (pre-uprate, post-uprate) shown in Figure 17(a), the difference between the water level in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all of the dates cited in Figure 17(a). Considering Scenario B (the dry condition) shown in Figure 17(b), the results are similar to those shown in Figure 17(a). Under pre-uprate conditions, a landward water-level gradient would be created around 15-Sep and 15-Nov, and under post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov. Under both historical conditions, the difference between the water levels in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all dates cited in Figure 17(b). The results shown in Figure 17 collectively show that


Exhibit 17 42 Pre-uprate condi#ons                                                Post-uprate condi#ons L-31E/ CCS dierence, "
This brief study consisted of reviewing and summarizing the relevant data and reports relating to the oper-ation of the cooling-canal system (CCS) at the Turkey Point power station, and focusing on three primary issues: (1) the temperature dynamics in the CCS, (2) the salinity dynamics in the CCS, and (3) the impacts andconsequencesofpumpingamaximumof100mgdfromtheL-31ECanalintotheCCS.
historical        projected 2015        projected 2016 0.80                                                                  0.80 0.40 0.30 "                                                            0.40 0.00                                                                  0.00
                          -0.40                                                                  -0.40 15-Jun  15-Jul  15-Aug  15-Sep  15-Oct  15-Nov  30-Nov          15-Jun    15-Jul      15-Aug    15-Sep      15-Oct    15-Nov  30-Nov (a) Scenario A (Normal Condi#ons)
Pre-uprate condi#ons                                                Post-uprate condi#ons L-31E/ CCS dierence, "
0.80                                                                  0.80 0.40 0.30 "                                                            0.40 0.00                                                                  0.00
                          -0.40                                                                  -0.40 15-Jun  15-Jul  15-Aug  15-Sep  15-Oct  15-Nov  30-Nov          15-Jun    15-Jul      15-Aug    15-Sep      15-Oct    15-Nov  30-Nov (a) Scenario B (Dry Condi#ons)
Figure 17: Differences Between L-31E Canal and CCS Water Levels. The historical difference is in blue, the projected 2015 difference is in orange, and the projected 2016 difference is in gray.
there is cause for concern that pumping 100 mgd from the L-31E Canal into the CCS could cause a landward water-level gradient where none previously existed. This concern is further exacerbated when considering that water levels at the northern end of the CCS near the discharge from the power-generating units will be higher that the average water level in the CCS that is used in this analysis, which further decreases the seaward water-level gradient between the L-31E Canal and the CCS. Concern is further heightened when the increased density of water in (and under) the CCS is taken into account, since the difference in equivalent freshwater (piezometric) heads between the L-31E Canal and the CCS is less that the difference in water levels between the L-31E Canal and the CCS. It is actually the difference in equivalent freshwater heads that govern the flow between these bodies of water (e.g., Post et al., 2007). This latter point is particularly important since the difference in freshwater heads between the L-31E Canal and the CCS will increase with depth.
Effect of generating a landward gradient. A landward gradient in the freshwater-equivalent piezometric head between the L-31E Canal and the CCS would advect saline water from the CCS towards the L-31E Canal. Such gradients are likely to be generated under 100-mgd pumping operations. Also, since pumping


Exhibit 17 43 would be occurring mostly during the wet season, it is likely that a seaward head gradient would exist (and be maintained) west of the L-31E Canal. As a consequence of a landward gradient in the freshwater-equivalent piezometric head east of the L-31E Canal and a seaward (freshwater) head gradient west of the L-31E Canal, it is possible that a saline circulation cell is developed in which water is pumped from the L-31E Canal into the CCS, water seeps out of the CCS and flows through the Biscayne Aquifer back into the L-31E Canal, and then this water is pumped back into the CCS. This circulation cell would increase the salinity in the L-31E Canal, which would degrade the quality of the water in the L-31E Canal and decrease the effectiveness of the pumped water in decreasing the salinity in the CCS.
Temperaturedynamics: TemperaturedynamicsintheCCSareaconcernprimarilybecauseoperationof the power-generating units will be impacted if the temperature of the cooling water at the intake exceeds 104F. Recentelevatedtemperatureshavecomeclosetoexceedingthisthresholdvalue. Understandingthe temperature dynamics in the CCS is not possible without the development of a heat-balance model of the CCS, and no such model currently exists in the public domain. As part of this study, a preliminary heat-balance model wasdevelopedand is described in this report. Using this model to simulate the heat balance intheCCSduringtheinterval9/1/10-12/7/14showedthatthereweretwodistinctperiodsduringwhichthe heat-rejection rate from the power plant remained approximately constant. The "rst period corresponded to pre-uprate conditions and the second period corresponded to post-uprate conditions. The heat-rejection rate during the second period was found to be signi"cantly greater than the heat-rejection rate during the "rst period. This "nding is not inconsistent with the condition that the post-uprate generating capacity of Exhibit 17
Historical anecdote. Interestingly, in 1978, engineers from the consulting firm Dames and Moore wrote a report to FPL with a specific section in their report titled Effects of an Overall Increase in Water Level in the Cooling-Canal System Relative to the Ground Water (Dames and Moore, 1978). In their report, the engineers at Dames and Moore specifically considered the impact of raising the water level in the CCS by 0.50 ft above the water table in the surrounding aquifer. They concluded that such an occurrence would cause the saltwater interface to move approximately one mile further inland relative to its location prior to the rise in the water level of the CCS.
4.4.2 Suggested Permit Modifications Based on the concerns described here, along with the supporting analyses provided, it is recommended that the pump-operation protocol associated with the 2015 - 2016 pumping permit be modified to include measurement of water levels in the CCS, and that a threshold water-level difference between the L-31E Canal and the CCS be determined by the SFWMD and added as a controlling factor in pump operations.
To ensure that a subsurface circulation cell of saline water does not develop, the salinity of the water in the L-31E Canal should be monitored during pump operations.
5    Conclusions and Recommendations This brief study consisted of reviewing and summarizing the relevant data and reports relating to the oper-ation of the cooling-canal system (CCS) at the Turkey Point power station, and focusing on three primary issues: (1) the temperature dynamics in the CCS, (2) the salinity dynamics in the CCS, and (3) the impacts and consequences of pumping a maximum of 100 mgd from the L-31E Canal into the CCS.
Temperature dynamics: Temperature dynamics in the CCS are a concern primarily because operation of the power-generating units will be impacted if the temperature of the cooling water at the intake exceeds 104 F. Recent elevated temperatures have come close to exceeding this threshold value. Understanding the temperature dynamics in the CCS is not possible without the development of a heat-balance model of the CCS, and no such model currently exists in the public domain. As part of this study, a preliminary heat-balance model was developed and is described in this report. Using this model to simulate the heat balance in the CCS during the interval 9/1/10 - 12/7/14 showed that there were two distinct periods during which the heat-rejection rate from the power plant remained approximately constant. The first period corresponded to pre-uprate conditions and the second period corresponded to post-uprate conditions. The heat-rejection rate during the second period was found to be significantly greater than the heat-rejection rate during the first period. This finding is not inconsistent with the condition that the post-uprate generating capacity of


Exhibit 17 44 the power-generating units served by the CCS is less than the pre-uprate generating capacity, since in the post-uprate generating capacity there is a significant shift from fossil-fuel generation to nuclear-power gen-eration, and nuclear-power units are known to have a much higher heat-rejection rate to cooling water than fossil-fuel generating units. The increased heat-rejection rate in the post-uprate period was manifested in the CCS by increased temperatures. Notably, the average temperature in the discharge zone increased by about 6.3 F (3.5 C) and the average temperature in the intake zone increased by about 4.7 F (2.6 C). Considering that the increased average temperature in the intake zone of the CCS is slightly greater that the increased threshold temperature of 4.0 F (2.2 C) approved by the NRC in 2014, and also considering that supplemen-tary cooling of the CCS was needed in 2014, then caution should be exercised in further increasing power generation beyond 2014 levels without a reliable system to provide additional cooling beyond that currently being provided by the CCS. A power-generation increase would likely lead to a repeat of the need for sup-plementary cooling that was experienced in 2014. There are also indications that the thermal efficiency of the CCS has decreased in the post-uprate period relative to the thermal efficiency in the pre-uprate period. A sensitivity analysis indicated that increased algae concentrations in the CCS and increased air temperatures are unlikely to have been of sufficient magnitude to cause the elevated temperatures that have been measured in the CCS. In quantitative terms, the additional heating rate in the CCS caused by the presence of high con-centrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the relatively small effect of algae-induced additional heating. The preliminary findings of this study will need to be followed up by further development of the thermal model supplemented by indirect measurements of heat-rejection rates, and (ideally) flows and temperatures within the CCS, that can be used to calibrate the model within each of the four zones of the CCS. The development of any engineered system to control temperatures in the CCS will need to be done in tandem with thermal-model simulations.
44
Salinity dynamics: Salinity in the CCS is a concern because increased salinity levels contribute to the increased salinity intrusion into the Biscayne Aquifer. Although an interceptor-ditch salinity-control system is in place, this system is ineffective in controlling salinity intrusion at depth, and so elevated salinities in the CCS remain a problem. This study confirms that long-term salinity increases in the CCS are caused by evaporation rates exceeding rainfall rates. Without any intervention, the trend of increasing salinity would continue into the future. Recent spikes in salinity in the CCS are a normal consequence of a prolonged rainfall deficit and can be expected to recur. Engineered systems that add less-saline water to the CCS to decrease salinity could have an adverse environmental impact caused by the increased water-level elevations in the CCS that these systems create. The effectiveness of an engineered system that pumps saline water from the CCS to deep-well(s) for disposal will depend on the groundwater-flow response in the aquifer sur-rounding the CCS, the induced salinity-transport dynamics within the aquifer, and the operational protocol of the deep-well injection system. The investigator was made aware through press reports that such a deep-well injection system has been approved for implementation, however, no supporting details were provided by Miami-Dade County to the investigator for further consideration during this study.
Pumping from the L-31E Canal: Pumping of up to 100 mgd from the L-31E Canal into the CCS is permitted between June 1 and November 30 during 2015 and 2016. Mass-balance modeling has shown that this level of pumping will likely raise the average water level in the CCS by around 0.5 ft, and since the historical water-level differences between the L-31E Canal and the CCS are also on the order of 0.5 ft, it is likely that there will be a significant reduction, or even reversal, of the historical seaward water-level gradient that would exist in the absence of pumping. It is even more likely that the water-level difference between the L-31E Canal and the CCS will be reduced below the 0.30-ft threshold that normally triggers the


Exhibit 17 45 ID salinity-control system. Model results show a likely reversal of gradient under some circumstances, and a consequence of this reversal could be the advection of a saline plume from the CCS to the L-31E Canal which would cause in increase in the salinity in the L-31E Canal, which is undesirable since the L-31E Canal is regarded as a source of freshwater in its various environmental functions.
the power-generating units served by the CCS is less than the pre-uprate generating capacity, since in the post-uprategeneratingcapacitythereisasigni"cantshiftfromfossil-fuelgenerationtonuclear-powergen-eration, and nuclear-power units are known to have a much higher heat-rejection rate to cooling water than fossil-fuelgeneratingunits. Theincreasedheat-rejectionrateinthepost-uprateperiodwasmanifestedinthe CCSbyincreasedtemperatures. Notably,theaveragetemperatureinthedischargezoneincreasedbyabout 6.3F(3.5C)andtheaveragetemperatureintheintakezoneincreasedbyabout4.7F(2.6C). Considering that the increased average temperature in the intake zone of the CCS is slightly greater that the increased thresholdtemperatureof4.0F(2.2C)approvedbytheNRCin2014,andalsoconsideringthatsupplemen-tary cooling of the CCS was needed in 2014, then caution should be exercised in further increasing power generationbeyond2014levelswithoutareliablesystemtoprovideadditionalcoolingbeyondthatcurrently being provided by the CCS. A power-generation increase would likely lead to a repeat of the need for sup-plementary cooling that was experienced in 2014. There are also indications that the thermal ef"ciency of theCCShasdecreasedinthepost-uprateperiodrelativetothethermalef"ciencyinthepre-uprateperiod. A sensitivity analysis indicated that increased algae concentrations in the CCS and increased air temperatures areunlikelytohavebeenofsuf"cientmagnitudetocausetheelevatedtemperaturesthathavebeenmeasured intheCCS.Inquantitativeterms,theadditionalheatingrateintheCCScausedbythepresenceofhighcon-centrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the relatively small effect of algae-induced additional heating. The preliminary "ndings of this study will need to be followed up by further development of the thermal model supplemented by indirect measurements of heat-rejection rates, and (ideally) "ows and temperatures within the CCS, that can be used to calibrate the model within each of the four zones of the CCS. The development of any engineered system to control temperaturesintheCCSwillneedtobedoneintandemwiththermal-modelsimulations.
Recommended action items.         Based on the aforementioned findings, the following action items should be considered:
 
* Develop a calibrated heat-balance model to simulate the thermal dynamics in the CCS. Essential additional measurements that are required to supplement the calibration of this model are synoptic measurements of volumetric flow rate through the power-generating units, intake temperature, and discharge temperature. Desirable additional measurements include synoptic measurements of the volumetric flow rate and temperature into and out of each CCS zone. The thermal model could be developed to simulate the effects of various supplementary cooling systems to support operation of the CCS.
Salinity dynamics: Salinity in the CCS is a concern because increased salinity levels contribute to the increasedsalinityintrusionintotheBiscayneAquifer. Althoughaninterceptor-ditchsalinity-controlsystem is in place, this system is ineffective in controlling salinity intrusion at depth, and so elevated salinities in the CCS remain a problem. This study con"rms that long-term salinity increases in the CCS are caused by evaporation rates exceeding rainfall rates. Without any intervention, the trend of increasing salinity would continue into the future. Recent spikes in salinity in the CCS are a normal consequence of a prolonged rainfall de"cit and can be expected to recur. Engineered systems that add less-saline water to the CCS to decreasesalinitycouldhaveanadverseenvironmentalimpactcausedbytheincreasedwater-levelelevations in the CCS that these systems create. The effectiveness of an engineered system that pumps saline water fromtheCCStodeep-well(s)fordisposalwilldependonthegroundwater-"owresponseintheaquifersur-rounding the CCS, the induced salinity-transport dynamics within the aquifer, and the operational protocol ofthedeep-wellinjectionsystem. Theinvestigatorwasmadeawarethroughpressreportsthatsuchadeep-wellinjectionsystemhasbeenapprovedforimplementation,however,nosupportingdetailswereprovided byMiami-DadeCountytotheinvestigatorforfurtherconsiderationduringthisstudy.
* Confirm and identify causative factors for the decline in the thermal efficiency of the CCS between the pre-uprate and post-uprate periods.
 
* Develop a quantitative relationship for estimating algae concentrations as a function of temperature, salinity, and nutrient levels in the CCS. Such a relationship could be derived using data that is already being collected. The developed model could be useful in managing the CCS, since algae concentra-tions affect the heat balance and possibly the thermal efficiency of the CCS.
Pumping from the L-31E Canal: Pumping of up to 100mgd from the L-31E Canal into the CCS is permitted between June 1 and November 30 during 2015 and 2016. Mass-balance modeling has shown that this level of pumping will likely raise the average water level in the CCS by around 0.5ft, and since the historical water-level differences between the L-31E Canal and the CCS are also on the order of 0.5ft, it is likely that there will be a signi"cant reduction, or even reversal, of the historical seaward water-level gradient that would exist in the absence of pumping. It is even more likely that the water-level difference betweentheL-31ECanalandtheCCSwillbereducedbelowthe0.30-ftthresholdthatnormallytriggersthe Exhibit 17
* Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature, wind speed, salinity, and algae concentrations in the CCS. This is justified since evaporation is the major cooling process in the CCS, and the evaporation model that is currently being used has a high uncertainty level. At present, a constant in the evaporation function is used as a calibration parameter in the salinity-balance model which is not a desirable circumstance given the importance of the evaporation process.
 
* The operational protocol associated with the 2015 - 2016 permit for transferring up to 100 mgd from the L-31E Canal to the CCS should be modified to include: (1) measurement of water levels in the CCS to preclude a landward equivalent freshwater head gradient being developed, (2) specification of threshold water-level difference between the L-31E Canal and the CCS as a controlling factor in pump operations, and (3) monitoring of the salinity of the water in the L-31E Canal during pump operations to ensure that CCS water is not seeping into the L-31E Canal.
45
The scope of this study was necessarily limited by the short (120-day) time frame that was available to in-vestigate all of the relevant issues. Follow-on and more detailed investigations will likely lead to a resolution of outstanding issues and the design of robust engineered systems to control the temperature and salinity in the CCS, as well as the extent of salinity intrusion associated with the operation of the CCS. All of these objectives can likely be accomplished with the goal of having sustainable power generation at the Turkey Point station.
 
IDsalinity-control system. Model results showa likelyreversalof gradient under some circumstances, and a consequence of this reversal could be the advection of a saline plume from the CCS to the L-31E Canal which would cause in increase in the salinity in the L-31E Canal, which is undesirable since the L-31E Canalisregardedasasourceoffreshwaterinitsvariousenvironmentalfunctions.
 
Recommendedactionitems. Basedontheaforementioned"ndings,thefollowingactionitemsshouldbe considered:
* Develop a calibrated heat-balance model to simulate the thermal dynamics in the CCS. Essential additional measurements that are required to supplement the calibration of this model are synoptic measurements of volumetric "ow rate through the power-generating units, intake temperature, and discharge temperature. Desirable additional measurements include synoptic measurements of the volumetric "ow rate and temperature into and out of each CCS zone. The thermal model could be developed to simulate the effects of various supplementary cooling systems to support operation of theCCS.
* Con"rm and identify causative factors for the decline in the thermal ef"ciency of the CCS between thepre-uprateandpost-uprateperiods.
* Develop a quantitative relationship for estimating algae concentrations as a function of temperature, salinity,andnutrientlevelsintheCCS.Sucharelationshipcouldbederivedusingdatathatisalready being collected. The developed model could be useful in managing the CCS, since algae concentra-tionsaffecttheheatbalanceandpossiblythethermalef"ciencyoftheCCS.
* Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature, wind speed, salinity, and algae concentrations in the CCS. This is justi"ed since evaporation is the major cooling process in the CCS, and the evaporation model that is currently being used has a high uncertainty level. At present, a constant in the evaporation function is used as a calibration parameter in the salinity-balance model which is not a desirable circumstance given the importance oftheevaporationprocess.
* The operational protocol associated with the 2015-2016 permit for transferring up to 100mgd from the L-31E Canal to the CCS should be modi"ed to include: (1) measurement of water levels in the CCStoprecludealandwardequivalentfreshwaterheadgradientbeingdeveloped,(2)speci"cationof thresholdwater-leveldifferencebetweentheL-31ECanalandtheCCSasacontrollingfactorinpump operations,and(3)monitoringofthesalinityofthewaterintheL-31ECanalduringpumpoperations toensurethatCCSwaterisnotseepingintotheL-31ECanal.
 
The scope of this study was necessarily limited by the short (120-day) time frame that was available to in-vestigatealloftherelevantissues. Follow-onandmoredetailedinvestigationswilllikelyleadtoaresolution ofoutstandingissuesandthedesignofrobustengineeredsystemstocontrolthetemperatureandsalinityin the CCS, as well as the extent of salinity intrusion associated with the operation of the CCS. All of these objectives can likely be accomplished with the goal of having sustainable power generation at the Turkey Pointstation.
Exhibit 17
 
46
 
References
 
[1] Adams, E., D. Harleman, G. Jirka, P. Ryan, and K. Stolzenbach. 1975. Heat disposal in the water environment. -. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources and Hydrody-namics,MassachusettsInstituteofTechnology.
 
[2] Brady,D.,W. Graves,andJ. Geyer. 1969. Surfaceheatexchangeatpowerplantcoolinglakes. Report No.5.Baltimore,MD:JohnsHopkinsUniversityPress.


Exhibit 17 46 References
[1] Adams, E., D. Harleman, G. Jirka, P. Ryan, and K. Stolzenbach. 1975. Heat disposal in the water environment. -. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources and Hydrody-namics, Massachusetts Institute of Technology.
[2] Brady, D., W. Graves, and J. Geyer. 1969. Surface heat exchange at power plant cooling lakes. Report No. 5. Baltimore, MD : Johns Hopkins University Press.
[3] Brown, L. and T. Barnwell Jr. 1987. The enhanced stream water quality models QUAL2E and QUAL2E-UNCAS: Documentation and Users Manual. - EPA/600/3-87/007. Athens, Georgia : U.S.
[3] Brown, L. and T. Barnwell Jr. 1987. The enhanced stream water quality models QUAL2E and QUAL2E-UNCAS: Documentation and Users Manual. - EPA/600/3-87/007. Athens, Georgia : U.S.
Environmental Protection Agency.
EnvironmentalProtectionAgency.
[4] Byers, H., H. Moses, and P. Harney 1949. Measurement of Rain Temperature. Journal of Meteorology 6:51-55.
 
[5] Chapra, S. 1997. Surface Water-Quality Modeling. New York, New York : McGraw-Hill, Inc.
[4] Byers,H.,H. Moses,andP. Harney1949. MeasurementofRainTemperature.JournalofMeteorology 6:51-55.
[6] Chin, D. 2013. Water-Quality Engineering in Natural Systems. Hoboken, New Jersey : John Wiley &
 
Sons Second edition.
[5] Chapra,S.1997. SurfaceWater-QualityModeling. NewYork,NewYork: McGraw-Hill,Inc.
 
[6] Chin,D.2013. Water-QualityEngineeringinNaturalSystems. Hoboken,NewJersey: JohnWiley&
SonsSecondedition.
 
[7] Cogley, J. 1979. The Albedo of Water as a Function of Latitude. Monthly Weather Review 107:775-781.
[7] Cogley, J. 1979. The Albedo of Water as a Function of Latitude. Monthly Weather Review 107:775-781.
[8] Dames and Moore 1971. Geohydrologic Conditions related to the Construction of Cooling Ponds.
 
[9] Dames and Moore 1977. Handout, January 1977 FCD/FP&L Semi-Annual Meeting, G-Series Wells Monitoring Program, Turkey Point, Florida Florida Power & Light Company.
[8] DamesandMoore1971. GeohydrologicConditionsrelatedtotheConstructionofCoolingPonds.
[10] Dames and Moore 1978. Salinity Evaluation Turkey Point Cooling Canal System Florida Florida Power & Light Company.
 
[11] Ecology and Environment, Inc. 2010. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[9] Dames and Moore 1977. Handout, January 1977 FCD/FP&L Semi-Annual Meeting, G-Series Wells MonitoringProgram,TurkeyPoint,FloridaFloridaPower&LightCompany.
[12] Ecology and Environment, Inc. 2011a. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
 
[13] Ecology and Environment, Inc. 2011b. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[10] Dames and Moore 1978. Salinity Evaluation Turkey Point Cooling Canal System Florida Florida Power&LightCompany.
 
[11] Ecology and Environment, Inc. 2010. Florida Power & Light Company Semi-Annual Report for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[12] Ecologyand Environment, Inc. 2011a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[13] EcologyandEnvironment, Inc. 2011b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[14] Ecology and Environment, Inc. 2012. Pre-Uprate Monitoring Report for Units 3 & 4 Uprate Project.
[14] Ecology and Environment, Inc. 2012. Pre-Uprate Monitoring Report for Units 3 & 4 Uprate Project.
    -. : Prepared for Florida Power & Light Company.
-.: PreparedforFloridaPower&LightCompany.
[15] Ecology and Environment, Inc. 2012a. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
 
[16] Ecology and Environment, Inc. 2012b. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[15] Ecologyand Environment, Inc. 2012a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[16] EcologyandEnvironment, Inc. 2012b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
Exhibit 17
 
47
 
[17] Ecology and Environment, Inc. 2012c. Comprehensive Pre-Uprate Monitoring Report for the Turkey PointUnits3&4UprateProject,Section3. -.: PreparedforFloridaPower&LightCompany.
 
[18] Ecologyand Environment, Inc. 2013a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[19] EcologyandEnvironment, Inc. 2013b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[20] EcologyandEnvironment,Inc. 2014. Post-UprateMonitoringReportforUnits3&4UprateProject.
-.: PreparedforFloridaPower&LightCompany.
 
[21] Ecologyand Environment, Inc. 2014a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[22] EcologyandEnvironment, Inc. 2014b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[23] Ecology and Environment, Inc. 2015. Florida Power & Light Company Semi-Annual Report for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.
 
[24] Fish, J. and M. Stewart. 1991. Hydrogeology of the sur"cial aquifer system, Dade County, Florida.
Water-ResourcesInvestigationsReportNo.90-4108.: UnitedStatesGeologicalSurvey.
 
[25] FloridaPowerandLightCompany2011. Tenyearpowerplantsiteplan: 2011-2010,Submittedtothe FloridaPublicServiceCommission.Miami,FL,April2011.
 
[26] GolderAssociates2008. CoolingCanalDataandAnalysisReport.
 
[27] Hakanson, L. and J. Eklund 2010. Relationships Between Chlorophyll, Salinity, Phosphorus, and NitrogeninLakesandMarineAreas. JournalofCoastalResearch26(3):412-423.
 
[28] Harbeck, Jr., G. 1955. The Effect of Salinity on Evaporation. Professional Paper No. 272-A. Wash-ington,DC:U.S.GeologicalSurvey.
 
[29] Howarth,R.andR. Marino2006. Nitrogenasthelimitingnutrientforeutrophicationincoastalmarine ecosystems: Evolvingviewsoverthreedecades. LimnologyandOceanography51(1,part2):364-376.
 
[30] Martin,J.andS. McCutcheon1998. HydrodynamicsandTransportforWaterQualityModeling. Boca Raton,Florida: LewisPublishers,Inc.
 
[31] Post, V., H. Kooi, and C. Simmons 2007. Using Hydraulic Head Measurements in Variable-Density GroundWaterFlowAnalyses. GroundWater45(6):664-671.
 
[32] RayL.LyerlyAssociates1973. ASummaryReportoftheTurkeyPointCoolingCanalSystem.
 
[33] RayL.LyerlyAssociates1998. ThermalPerformanceoftheCCS.
 
[34] Ryan,P.andD. Harleman. 1973. Analyticalandexperimentalstudyoftransientcoolingpondbehav-ior. Technical Report No. 161. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources andHydrodynamics,MassachusettsInstituteofTechnology.
Exhibit 17
 
48
 
[35] Salhorta,A.,E. Adams,andD. Harleman1985. EffectofSalinityandIonicCompositiononEvapo-ration: AnalysisofDeadSeaEvaporationPans. WaterResourcesResearch21(9):1336-1344.
 
[36] Sharqawy, M., J. Lienhard V, and S. Zubair 2010. The thermophysical properties of seawater: A reviewofexistingcorrelationsanddata. DesalinationandWaterTreatment16:354380.
 
[37] SouthFloridaWaterManagementDistrict2008. SFWMDMemotoFDEP.
 
[38] SouthFloridaWaterManagementDistrict2015.EmergencyFinalOrderNumber2015-034-DAO-WU.
WestPalmBeach,Florida.


Exhibit 17 47
[39] United States Nuclear Regulatory Commission 2012. Location of projected new nuclear power reac-tors.UpdatedMarch2012.Accessed: April2012.
[17] Ecology and Environment, Inc. 2012c. Comprehensive Pre-Uprate Monitoring Report for the Turkey Point Units 3 & 4 Uprate Project, Section 3. -. : Prepared for Florida Power & Light Company.
[18] Ecology and Environment, Inc. 2013a. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[19] Ecology and Environment, Inc. 2013b. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[20] Ecology and Environment, Inc. 2014. Post-Uprate Monitoring Report for Units 3 & 4 Uprate Project.
    -. : Prepared for Florida Power & Light Company.
[21] Ecology and Environment, Inc. 2014a. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[22] Ecology and Environment, Inc. 2014b. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[23] Ecology and Environment, Inc. 2015. Florida Power & Light Company Semi-Annual Report for the Turkey Point Monitoring Project. -. : Prepared for Florida Power & Light Company.
[24] Fish, J. and M. Stewart. 1991. Hydrogeology of the surficial aquifer system, Dade County, Florida.
Water-Resources Investigations Report No. 90-4108. : United States Geological Survey.
[25] Florida Power and Light Company 2011. Ten year power plant site plan: 2011-2010, Submitted to the Florida Public Service Commission. Miami, FL, April 2011.
[26] Golder Associates 2008. Cooling Canal Data and Analysis Report.
[27] Hakanson, L. and J. Eklund 2010. Relationships Between Chlorophyll, Salinity, Phosphorus, and Nitrogen in Lakes and Marine Areas. Journal of Coastal Research 26(3):412-423.
[28] Harbeck, Jr., G. 1955. The Effect of Salinity on Evaporation. Professional Paper No. 272-A. Wash-ington, DC : U.S. Geological Survey.
[29] Howarth, R. and R. Marino 2006. Nitrogen as the limiting nutrient for eutrophication in coastal marine ecosystems: Evolving views over three decades. Limnology and Oceanography 51(1, part 2):364-376.
[30] Martin, J. and S. McCutcheon 1998. Hydrodynamics and Transport for Water Quality Modeling. Boca Raton, Florida : Lewis Publishers, Inc.
[31] Post, V., H. Kooi, and C. Simmons 2007. Using Hydraulic Head Measurements in Variable-Density Ground Water Flow Analyses. Ground Water 45(6):664-671.
[32] Ray L. Lyerly Associates 1973. A Summary Report of the Turkey Point Cooling Canal System.
[33] Ray L. Lyerly Associates 1998. Thermal Performance of the CCS.
[34] Ryan, P. and D. Harleman. 1973. Analytical and experimental study of transient cooling pond behav-ior. Technical Report No. 161. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources and Hydrodynamics, Massachusetts Institute of Technology.


Exhibit 17 48
[35] Salhorta, A., E. Adams, and D. Harleman 1985. Effect of Salinity and Ionic Composition on Evapo-ration: Analysis of Dead Sea Evaporation Pans. Water Resources Research 21(9):1336-1344.
[36] Sharqawy, M., J. Lienhard V, and S. Zubair 2010. The thermophysical properties of seawater: A review of existing correlations and data. Desalination and Water Treatment 16:354380.
[37] South Florida Water Management District 2008. SFWMD Memo to FDEP.
[38] South Florida Water Management District 2015. Emergency Final Order Number 2015-034-DAO-WU.
West Palm Beach, Florida.
[39] United States Nuclear Regulatory Commission 2012. Location of projected new nuclear power reac-tors. Updated March 2012. Accessed: April 2012.
[40] Williams, G. and D. Tomasko 2009. A simple quantitative model to estimate consumptive evapora-tion impacts of discharged cooling water with minimal data requirements. Energy and Environment 20(7):1155-1162.}}
[40] Williams, G. and D. Tomasko 2009. A simple quantitative model to estimate consumptive evapora-tion impacts of discharged cooling water with minimal data requirements. Energy and Environment 20(7):1155-1162.}}

Revision as of 07:02, 13 November 2024

Exhibit 17 - Chin_Cooling Canal System at the FPL Turkey Point Power Station
ML23331A980
Person / Time
Site: Turkey Point  NextEra Energy icon.png
Issue date: 11/27/2023
From:
Miami Waterkeeper
To:
NRC/SECY/RAS
SECY RAS
References
RAS 56848, 50-250-SLR-2, 50-251-SLR-2
Download: ML23331A980 (0)


Text

EXHIBIT 17 Exhibit 17 1

TheCooling-CanalSystemattheFPLTurkeyPointPowerStation

ByDavidA.Chin,Ph.D.,P.E.,D.WRE,BCEE ProfessorofCivilandEnvironmentalEngineering UniversityofMiami

ExecutiveSummary

This report was prepared under an agreement between Miami-Dade County and the University of Miami.

The following issues related to the operation of the cooling-canal system (CCS) at the Turkey Point Power Stationwereinvestigated: (1)temperaturevariationsintheCCSandassociatedimpactsonthesurrounding groundwater, (2) salinity variations in the CCS and associated impacts on the surrounding groundwater, and (3) the effects of pumping up to 100 million gallons per day from the L-31E Canal into the CCS.

The principal "ndings of this investigation are summarized below, with analytical details supporting the "ndings contained in the body of the report. Data for this study was provided by the Miami-Dade County Department of Regulatory and Economic Resources. CCS temperature and salinity data for the four-year intervalof9/1/10-12/7/14weremadeavailableforthisinvestigation.

Temperature in the CCS. A heat-balance model was developed to simulate the temperature dynamics in the CCS. The results derived from the heat-balance model showed that there were two distinct periods duringwhichtheheat-rejectionratefromthepowerplantremainedapproximatelyconstant. The"rstperiod corresponded to pre-uprate conditions, and the second period corresponded to post-uprate conditions. The heat-rejectionrateduringthesecondperiodwasfoundtobesigni"cantlygreaterthantheheat-rejectionrate duringthe"rstperiod. AsaresultoftheincreasedheatadditiontotheCCS,theaveragetemperatureofwater intheCCShasincreased,andinthevicinityofthepower-plantintaketheaveragetemperaturehasincreased by approximately 2.6C (4.7F). This measured increase in average temperature within the intake zone is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2C (4.0F) that was approved by the Nuclear Regulatory Commission in 2014. Therefore, the increased maximum operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, which currently stands at 104F. Since supplementary cooling of the CCS was needed in 2014, this serves as a cautionary note regarding further increases in power generation beyond 2014 levels withoutprovidingareliablesupplementarycoolingsystem. Measuredtemperaturedataduringtheperiodof recordindicatethatthethermalef"ciencyoftheCCShasdecreasedbetweenthepre-uprateandpost-uprate periods. Furtherinvestigationisrecommendedtocon"rmthedecreaseinthermalef"ciencyoftheCCSand identify the causative factor(s). The assertion that higher algae concentrations in the CCS were responsible for the elevated temperatures in the CCS was investigated. A sensitivity analysis indicates that increased algae concentrations were not likely to have been responsible for the signi"cantly elevated temperatures in the CCS recorded in the mid-summer months of 2014. The additional heating rate in the CCS caused by the presence of high concentrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the minimal impact. Further development of the heat-balance model is needed, sincethedesignofanyengineeredsystemtocontroltemperaturesintheCCSmustbedoneintandemwith heat-balance-modelsimulations.

Temperature impact on groundwater. Measured groundwater temperatures in some monitoring wells betweentheCCSandtheL-31ECanalhaveshownhighertemperaturesthangroundwaterwestoftheL-31E Exhibit 17

2

Canal, and this occurrence can be partially attributed to limited cooling-canal water intrusion into the Bis-cayne Aquifer. Monitoring-well measurements further show that nearly all of the seasonal temperature "uctuations in the groundwater occur above an elevation of 25 ft NGVD* (about 30ft below the ground surface). Atlowerelevationsintheaquifer,thegroundwatertemperaturegenerallyremainsrelativelysteady and in the range of 75F-77F(24C-25C). Seasonal temperature "uctuations above 25 ft NGVD can bepartiallyattributedtotheheatingandcoolingofwaterintheL-31ECanalinresponsetoseasonalchanges inatmosphericconditions. Overall,theimpactofCCSwateronthetemperatureofgroundwaterintheBis-cayneAquifercanbeconsideredaslocalizedofnothavinganysigni"cantenvironmentalconsequence.

SalinityintheCCS. TherehasbeenasteadyincreaseinCCSsalinityofaround5perdecadesincethe CCS began operation in 1973. Recent measurements indicate that the rate of change of salinity might be increasing. AnalysesofthesalinitydynamicsintheCCSwereperformedusingasalinitymodelpreviously developed by a FPL contractor. Results from this salinity model show that evaporation and rainfall are the primary drivers affecting the salinity in the CCS, with pumpage from the interceptor ditch and blowdown fromtheUnit5generatingfacilityalsohavinganeffect. Overprolongedperiodswithnorainfall,thesalinity intheCCSwillgenerallyincreaseasfreshwaterisevaporatedandtheevaporatedfreshwaterisreplacedby salinewaterfromthesurroundingaquifer. Aprolongedperiodwithnorainfallwastheprimarycauseforthe unusually high salinities (greater than 90) that were observed in early summer of 2014. Seepage in"ow to the CCS is mostly from the east (i.e., the area adjacent to Biscayne Bay) and seepage out"ow of more saline water occurs primarily through the bottom of the CCS, thereby contributing to an increased salinity of the underlying groundwater. The short-term (seasonal) salinity "uctuations in the CCS are controlled by seasonalvariationsintheamountandtimingofrainfall,andaperiodicspikesinsalinityshouldbeconsidered asbeingnormalandexpected. Inthelongterm,barringanysigni"cantintervention,salinitieswillcontinue to follow an upward trend, since over the long term annual evaporation exceeds annual rainfall. Increased temperatures in the CCS lead to increased evaporation which increases the rate of change of salinity in the CCS above historical rates of change. The steady increase in salinity could be mitigated by an engineered systemtoaddsupplementalwaterwithlessersalinity. However,pumpinglowersalinitywaterintotheCCS in large quantities will elevate the water level in the CCS, decrease the seaward piezometric-head gradient, and likely exacerbate the inland intrusion of saltwater originating from the CCS. The effectiveness of an engineered system that pumps saline water from the CCS to deep-well(s) for disposal will depend on the groundwater-"ow response in the aquifer surrounding the CCS, the induced salinity-transport dynamics withintheaquifer,andtheoperationalprotocolofthedeep-wellinjectionsystem. Datainsupportofsucha proposedsystemwasnotmadeavailabletotheinvestigatorduringthisstudy.

Salinity impact on groundwater. Based on available documentation and data summaries contained in numerous reports prepared by FPL, SFWMD, and DERM, there is little doubt that seepage from the CCS into the Biscayne Aquifer has caused salinity increases within the aquifer, and this impact extends several milesinlandfromtheCCS.Thestrongestevidenceforthisassertioncomesfromtheanalysisoftritiumdata.

The CCS contains water with a high tritium concentration, and utilization of tritium as a tracer to identify groundwater originating from the CCS is justi"ed. Elevated concentrations of tritium above a 20pCi/L thresholdinthedeepgroundwatercanreasonablybeattributedtothepresenceofwateroriginatingfromthe CCS. The approximate limit of the 20 pCi/L concentration contour has been reported to be 3.8-4.7miles westoftheCCSand2.1mileseastoftheCCS.

  • NGVDreferstotheNGVD29datum.

Exhibit 17

3

Withdrawalof100mgdfromtheL-31ECanal. Adverse impacts of pumping 100mgd from the L-31E Canal into the CCS during June 1-November 30 are likely to occur under the current permitted pumping protocol. Under the current pumping protocol stipulated in the SFWMD-issued permit, the stage in the L-31ECanalwillbeheldconstantduringpumping,whilethestageintheCCSwillgenerallyriseasaresult ofpumping. Thiscombinedeffectwilldecrease,orpossiblyreverse,theseawardpiezometric-headgradient between the L-31E Canal and the CCS that would normally exist in the absence of pumping. A possible consequence of a reversed head gradient between the L-31E Canal and the CCS is advection of a saline plumefromtheCCStowardstheL-31ECanal,andcreationofacirculationcellinwhichthesalinityofthe waterintheL-31ECanalisincreasedasthesalineplumeenterstheL-31ECanal. Furthermore,accordingto model results providedby FPL in support of the pumping-permit application, pumping of 100mgd into the CCSislikelytoreducethewater-leveldifferentialbetweentheL-31ECanalandtheCCStobelowthe0.30ft threshold that would normally trigger the operation of the interceptor ditch salinity-control system, which, if operational, would further reduce the head gradient between the L-31E Canal and the CCS. Based on these"ndings,itisrecommendedthatthepermittedpumpingprotocolberevisedpriortothe2016pumping period. The revised protocol should include, as a minimum, real-time monitoring of the stages in the CCS andtheL-31ECanalduringpumpingoperations,speci"cationofathresholdwater-leveldifferencebetween the L-31E Canal and the CCS that would limit further pumping, and real-time monitoring of the salinity in theL-31ECanalduringpumpingoperations.

Recommendedactions. Thefollowingspeci"cactionitemswouldleadtobetterandmoreef"cientman-agementofthecooling-canalsystem:

  • Developacalibratedheat-balancemodeltosimulatethethermaldynamicsintheCCS,andcollectthe datanecessarytocalibrateandvalidatethismodel.
  • Con"rmandidentifythecausativefactorsforthedeclineinthethermalef"ciencyoftheCCSbetween thepre-uprateandpost-uprateperiods.
  • Develop a quantitative relationship for estimating algae concentrations in the CCS as a function of temperature,salinity,andnutrientlevels.
  • Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature,windspeed,salinity,andalgaeconcentrationsintheCCS.
  • Modifytheoperationalprotocolassociatedwiththe2015-2016permitfortransferringupto100mgd fromtheL-31ECanaltotheCCS.

Theanalysesandrecommendationscontainedinthisreportareofferedinsupportofthegoalofachievingan environmentalbalanceforthesustainablegenerationofelectricalpowerattheTurkeyPointpowerstation.

Exhibit 17

4

(Thispageisintentionallyleftblank.)

Exhibit 17

5

Contents

1 Background 6 1.1 TurkeyPointPowerStation................................... 6 1.2 Geohydrology.......................................... 7 1.3 TheCooling-CanalSystem................................... 8 1.4 AlgaeintheCCS........................................ 9 1.5 SaltwaterIntrusion....................................... 12 1.6 L-31ECanalandInterceptorDitch............................... 13

2 TemperatureVariationsintheCoolingCanals 15 2.1 ResultsfromPreviousStudies................................. 15 2.1.1 TemperaturesintheCCS................................ 15 2.1.2 ThermalEf"ciencyoftheCCS............................. 16 2.1.3 ThermalEffectsonGroundwater............................ 16 2.2 Heat-BalanceModelofCCS.................................. 17 2.2.1 Heat-BalanceModelFormulation........................... 17 2.2.2 Heat-FluxComponents................................. 18 2.2.3 Heat-BalanceEquations................................ 22 2.2.4 ModelResults..................................... 23 2.2.5 Conclusions....................................... 27

3 SalinityVariationsintheCoolingCanals 28 3.1 ResultsfromPreviousStudies................................. 29 3.1.1 HistoricalChlorideLevels............................... 29 3.1.2 HistoricalSpeci"cConductanceLevels........................ 30 3.2 Salinity-BalanceModelofCCS................................ 30 3.2.1 Salinity-BalanceModelFormulation.......................... 30 3.2.2 PreviousModelResults................................ 31 3.2.3 AnalysisofSalinityDynamics............................. 32 3.2.4 DemonstrationofSalinityDynamics.......................... 33

4 PumpingWaterfromtheL-31ECanalintotheCoolingCanals 34 4.1 PumpingPermitandProtocols................................. 34 4.2 QuantitativeEffects....................................... 37 4.3 ModelResults.......................................... 38 4.4 EnvironmentalEffects..................................... 39 4.4.1 EffectofIncreasedWater-SurfaceElevationsintheCCS............... 39 4.4.2 SuggestedPermitModi"cations............................ 43

5 ConclusionsandRecommendations 43 Exhibit 17

6

1 Background

This investigation is primarily focused on the operation of the cooling-canal system (CCS) located at the Turkey Point power-generating station in south Miami-Dade County, Florida. The issues of concern relate primarilytotheincreasedtemperaturesandsalinitiesthathaverecentlybeenmeasuredintheCCS,theenvi-ronmentalimpactsoftheseincreasedlevelsonthequalityofgroundwaterintheBiscayneAquifer,theneed for additional engineered systems to supply supplemental cooling water to the CCS, and the environmental impactsofpermittedpumpingofupto100mgdofwaterfromtheL-31ECanaltotheCCSbetweenJune1 andNovember30.

Environmental concerns. Most of the environmental concerns regarding the operation of the cooling-canal system (CCS) at Turkey Point relate to: (1) the sustainability of the system in maintaining adequate temperatures to cool the power-generating units, (2) the impact that current and projected future salinities in the CCS have on the quality of groundwater in the surrounding Biscayne Aquifer, and (3) the need for new supplementary sources of water and/or revised operational protocols to control the temperatures and salinitiesintheCCS.Speci"cissuesofconcernareasfollows:

  • Increased temperatures in the CCS limit the effectiveness of the CCS as a cooling-water source ser-vicing four power-generating units. When the intake temperature in the CCS exceeds a regulatory limiting value of 104F, either power generation must be curtailed or supplementary cooling water must be provided to the CCS to reduce the temperature and hence keep the generating units in op-eration; the sustainability of a supplementary system to cool the water in the CCS has not yet been established.
  • Increased salinity in the CCS likely contributes to increased saltwater intrusion within the Biscayne Aquifer, thereby deteriorating the groundwater quality underlying inland areas. The current salinity-control system, sometimes called the interceptor-ditch system, has not been effective in controlling the inland migration of saline water from the CCS, thereby signaling the need for revised operating strategiestomanagesalinityintrusionresultingfromCCSoperation.
  • Theeffectivenessofthepermittedprotocolforpumping100mgdfromtheL-31ECanalintotheCCS to reduce temperatures in the CCS, and the effect of this pumping operation on saltwater intrusion in theBiscayneAquiferandwaterqualitywithintheL-31ECanalareissuesthatareyettoberesolved.

This report summarizes what is currently known about the CCS, summarizes key "ndings from previous related investigations, regulatory reports and reviews, provides new analyses, and gives suggested answers andpathwaysforwardtoresolveseveralissuesrelatedtotheabove-listedconcerns.

1.1 TurkeyPointPowerStation The Turkey Point Power Station currently consists of "ve power-generating units: two 404-MW oil/natural gas-"redgeneratingunits(Units1and2),two728-MWnuclear-poweredunits(Units3and4),andanomi-nal1150-MWnaturalgas-"redcombined-cycleunit(Unit5). In2002,theNuclearRegulatoryCommission (NRC) extended the operating licenses for both nuclear reactors from forty years to sixty years, extending licensed operation to the year 2033. In June of 2009 the Florida Department of Environmental Protection (FDEP)issuedcerti"cationfortheincreaseinpower-generatingcapacity(commonlycalledanuprate)of Exhibit 17

7

Units 3 and 4 to provide an additional 250MW of power. Unit 3 has been operating at its uprated power-generation capacity since Nov 2012, and Unit 4 has been operated at its uprated power-generation capacity since May 2013. In planning for the Unit 3 and Unit 4 uprates, it was anticipated that the uprate would increase the temperature of the cooling water discharged to the CCS by 2.5F (1.4C), from 106.1F to 108.6F (41.2C to 42.6C) (FPL 2011), and that the increased temperature in the CCS might result in in-creased evaporation and increased salinity. The CCS provides cooling water for Units 1 to 4, with cooling of Unit5 accomplished by mechanical-draft cooling towers that use make-up water drawn from the Upper Floridan Aquifer. Blowdownwaterfrom Unit5 is dischargedinto the CCS. Since the uprate of Units 3 and 4 went into effect, Unit 2 has not been operational. In 2014, the Florida legislature approved construction of two additional nuclear reactors at Turkey Point (Units 6 and 7), with each additional unit having an ap-proximate electrical output of 1100MW; approval of the additional units by the NRC is currently pending.

The two additional nuclear reactors will not use the CCS for cooling. Presently, with an estimated total power-station capacity of approximately 3550MW, the Turkey Point power station is the second largest powerstationinFlorida,intermsofgeneratingcapacity,andisthesixthlargestpowerstationintheUnited States(NRC,2012).

1.2 Geohydrology The Turkey Point power station and associated cooling-canal system (CCS) are underlain by the Biscayne Aquifer. In the vicinity of Turkey Point, the Biscayne Aquifer extends from land surface to a depth of ap-proximately 106ft below sea level (BSL), with the thickness of the aquifer decreasing towards the west.

Geologic formations within the Biscayne Aquifer include, from the ground surface downward, the Miami Limestone Formation, Key Largo/Fort Thompson Formations, and upper portions of the Tamiami Forma-tion. The less-permeable units of the Tamiami Formation, and the deeper Hawthorn Group, form the con-

"ning unit between the Biscayne Aquifer and the Upper Floridan aquifer. The top of the con"ning unit is characterized by the transition between highly permeable beds of the Fort Thompson Formation and the lower-permeabilitysiltysandsoftheTamiamiFormation. ThethicknessoftheMiamiLimestoneFormation is in the range of 8-23ft, and the thickness of the Fort Thompson Formation is in the range of 46-95ft.

The regional groundwater "ow direction is, on average, from the northwest to southeast (Fish and Stewart 1991), although the predominant "ow direction at the coast can vary signi"cantly between the wet and dry seasons. The water-table gradient is typically towards the coast during the wet season (May-October),

but can be directed inland during the dry season (October-April). The possibility of the occurrence of an inland water-table gradient is the primary reason for the so-called interceptor-ditch system that is used ostensibly to control the inland migration of saline water originating from the CCS. Water-table elevations atTurkeyPointaretypicallyaround1ftNGVD,andthemagnitudeoftheaverageregionalwater-tablegra-dient is typically in the range of 0.004%-0.005%. Notably, with such small water-table gradients, small errors in measured water-table elevations can signi"cantly impact the accuracy of the estimated gradients.

Vertical piezometric-head gradients at the Turkey Point site (away from the CCS) are typically negligible, with piezometric-head differentials between shallow, intermediate, and deep zones reportedly being within hundredthsofafoot.

Groundwater classi"cation. Groundwater at the Turkey Point site was originally classi"ed by FDEP as as G-II, which is the classi"cation for groundwater that is of possible potable use and has a total dissolved solids content of less than 10,000mg/L. In September 1983, at the request of FPL, the groundwater at the Turkey Point site was reclassi"ed by FDEP as G-III, which is the classi"cation for groundwater that Exhibit 17

8

has a total dissolved solids content of 10,000mg/L or greater, or has a total dissolved solids of 3,000-10,000mg/L and has no reasonable potential as a future source of drinking water. The G-III classi"cation currentlyremainsineffect.

1.3 TheCooling-CanalSystem History and regulation. Construction of the cooling-canal system (CCS) was approved by the Dade CountyBoardofCountyCommissionersinNovember1971,andbecameoperationalinFebruary1973. At thetimeofitsinitialoperation,theCCSwasapproximatelyhalf-waycompletedcomparedwiththepresent system. TheCCSissometimesreferredtoasanIndustrialWastewaterFacility(IWW)sincethecirculating water system, which discharges saline water to the surrounding aquifer, is regulated under the federal Na-tional Pollutant Discharge Elimination System (NPDES) and an Industrial Wastewater (IW) permit issued toFPLbytheFloridaDepartmentofEnvironmentalProtection.

Currentcanalsystem. Initspresentstate,theCCSisapproximatelytwomileswide(east-west)and"ve miles long (north-south), covers an area of approximately 5900acres, and has approximately 4370acres of water surface. The CCS consists of 32 canals "owing south from the discharge location in the north, and 7 return canals "owing north to the intake location. Because the south-"owing canals are located in the western section of the CCS and the north-"owing canals are located in the eastern section of the CCS, the system is sometimes referred to as having 32 western canals and 7 eastern canals. The south-"owing (western) canals are each approximately 4ft deep, 200ft wide, and spaced approximately 90ft apart; these canals range in length from 2-5miles. The 4ft depth of the canals (from ground surface) was originally chosen so as to not penetrate the less-permeable sur"cial Miami Oolite Formation that extends to about 4ftbelowgrade,therebyminimizinggroundwaterexchangebetweentheCCSandtheunderlyingBiscayne Aquifer. The bottom of the canals are below the lowest water-table elevation expected in the Biscayne Aquifer at Turkey Point, and therefore the canals always contain water that is directly connected to the adjacentgroundwater. Coolingwaterleavesthefourgeneratingunits(Units1-4),"owsintoLakeWarren, and then into the 20-ft deep 100-ft wide feeder canal that connects to the 32 south-"owing cooling canals.

Four shallow cross canals spaced 1-mile apart run east-west across the 32 south-"owing cooling canals.

These cross canals contain "ow-control structures that distribute water "ow evenly to the canals so that each cooling canal carries a "ow that is proportional to its surface area in order to optimize heat exchange with the atmosphere. At the southern end of the CCS is a collector canal that is approximately 20ft deep and 200ft wide. Water returns to the power-generating units from the southern collector canal via 6 north-

"owing canals, the largest of which is the Card Sound Canal which is 200ft wide and 20ft deep. The average length of the circulation path between the discharge and intake locations is 13.4 miles. The 32 south-"owing cooling canals are numbered from 1 to 32, from east to west, hence, cooling-canal number 32 is the westernmost canal in the CCS. Endangered American crocodiles (Crocodylus acutus) inhabit the cooling canals. During nesting season, more than 40 adult crocodiles have been observed in the canals, although there have been some reports that the crocodile population in the CCS is declining possibly due directlyorindirectlytotheincreasedsalinitiesintheCCS.

Operational characteristics. The canals in the CCS were designed to operate at a total "ow rate of 4250ft3/s (2750mgd) when all four generating units (Units 1-4) supported by the CCS are in full oper-ation. Small wastewater (blowdown) "ows from Unit5 are also discharged into the CCS. Typically, the "ow rate through the CCS varies signi"cantly with the electric load demand on the generating units, and is Exhibit 17

9

usually in the range of 2700-4250ft3/s (1750-2750mgd) on any given day, with a typical "ow depth of around 2.8ft. Thermal energy is dissipated in CCS as water moves from north to south, with the primary heat-exchangeprocessesbeingevaporation,solarradiation,andbothemittedandabsorbedlongwaveradia-tion. Maximumtemperaturesnearthedischargelocationofthepower-generatingunitsaretypicallyaround 108F (42C), and maximum temperatures near intake to the power-generating units are typically around 93F(34C);thedifferencebetweenthesetypicalmaximais15F(8C),whichgivesameasureofthecool-ing effect of the CCS. The (regulated) maximum allowable temperature at the intake location in the CCS is 104F (40C). The "ow in the CCS is driven by 12 condenser-circulating pumps and auxiliary cooling pumps. The CCS typically contains approximately 7  10 8 ft3 of water, and the average velocity is around 0.25ft/sineachcanal. Approximatelytwodays(44-48h)arerequiredforwaterintheCCStotravelfrom the discharge location to the intake location. Within the CCS, the "ow is maintained by a head differential between the discharge and intake locations, with the water-surface elevation being highest at the discharge location and lowest at the intake location. The water level at the discharge location is typically about 3ft higher than the water level at the intake location. Typical water surface elevations in the CCS are 2.04ft NGVD at the discharge location, 0.76ft NGVD at the south end, and 0:77 ft NGVD at the intake loca-tion. Thewater-surfaceelevationatsouthendoftheCCSisusuallyclosesttothewater-surfaceelevationin Biscayne Bay. The water-surface elevation in the CCS is typically higher than the site-average water-table elevation in the Biscayne Aquifer at the discharge (north) end of the system, approximately equal to the water-table elevation at the south end of the system, and below the water table at the intake (north) end of thesystem. Consequently,watergenerally"owsoutoftheCCSintotheaquifernearthedischargelocation of the CCS and water generally "ows into the CCS from the aquifer near the intake location of the CCS, thereisless"owinteractionbetweentheCCSandtheaquiferatthesouthernendofthesystem. Duringvery heavy rains, there can be a net in"ow to the CCS from the surrounding aquifer. The CCS is approximately nontidal, and water in the CCS is typically warmer than the air temperature. The effectiveness of the CCS asacoolingsystemdecreasesasthetemperatureintheCCSincreases.

1.4 AlgaeintheCCS A signi"cant algae bloom occurred in the CCS during 2014 and algae in now perceived to be a problem in theCCS.Priorto2013,onlylimitedandshort-termalgaebloomshadoccurredintheCCS,typicallyduring the early summer months. In fact, algae blooms were of such limited concern that routine monitoring for algae was not commonly done prior to 2014. In the summer of 2014, large-scale application of a CuSO4-basedalgaecidewasusedtoreducethealgaeconcentrationsintheCCS.Theappliedalgaecidewasreported asbeingineffectiveinreducingthealgaeconcentrations,servingonlytostabilizetheexistingconcentrations (SFWMD,2015).

Factors affecting algae concentrations. High concentrations of algae have been observed in the CCS withcorrespondinglyhighconcentrationsofnutrientsbeingmeasured. Thehistoricalaveragealgaeconcen-trationintheCCSisreportedtobe50cell/L,however,inthesummerof2014algaeconcentrationsashigh as 1600cell/L were reported (SFWMD, 2015). The addition of nutrients from the power-generating units intotheCCSisassumedtobenegligible,withnutrientslikelyoriginatingfromallochthonoussources. Total nitrogen (TN) concentrations in the CCS have been reported in the range of 1.7-5.3mg/L (Ecology and Environment,Inc.,2012). ThehighestreportedTNconcentrationsintheCCSweremeasuredatallstations in March 2012, which coincided with higher turbidities and pH in the CCS. The majority of the nitrogen

AlgaeconcentrationsarenormallygiveninChla /L,sotheseunitsareunusual.

Exhibit 17

10

in the CCS appears to be in organic form (typically 80%-90%). Total phosphorus (TP) concentrations in the CCS have been reported in the range of 4-73 g/L, with an overall average concentration of 36 g/L.

NumerousmeasurementsofTNandTPhavebeenreportedbetween7/2010and3/2015(EcologyandEnvi-ronment,Inc.,2010;2011a;2011b;2012a;2012b;2012c;2013a;2013b;2014a;2014b;2015),andsynoptic measurements within this time period yield TN/TP values in the range of 48-2015 with a median value of 142. Since the measured TN/TP values generally exceed the Red"eld ratio of 16, it can be inferred that TP isthecontrollingnutrientforalgaegrowthintheCCS.TheexistenceofTPcontrolofalgaegrowthinsaline systemsiscommonlyattributedtothepresenceofnitrogen-"xingplanktoniccyanobacteriawhichmakeup any short-term nitrogen de"cits (Howarth and Marino, 2006). It has been reported that the cyanobacteria Aphanothece sp. are the predominant algae species in the CCS; these species are nitrogen-"xing and thrive under hypersaline conditions. In addition to nutrients, both temperature and salinity are known to affect the growth of algae in water bodies. For given nutrient levels, increasing temperatures usually contribute to increased algae concentrations, and increasing salinities usually contribute to decreased algae concen-trations (Hakanson and Eklund, 2010). However, for the algae species commonly found within the CCS, algae concentrations have been reported to increase with increasing salinity (SFWMD, 2015). Algae con-centrations are usually expressed in terms of the mass of chlorophyll-a per liter. Synoptic measurements of chlorophyll-a (Chla ) concentration, salinity (S ), temperature (T ), and total phosphorus (TP) concentra-tion at locations near the discharge and intake locations in the CCS between May 31, 2015 and November 13, 2015 are plotted in Figure 1. These synoptic measurements collectively show the algae concentration

Figure1: Chlorophyll-a levelsintheCCSasafunctionoftemperature,salinity,andtotalphosphorus

(Chla ) decreasing with increasing salinity (S ), decreasing with increasing temperature (T ), and decreasing Exhibit 17

11

with increasing nutrient concentration (TP). All of these trends are contrary to the natural relationships be-tween Chla,S,T, and TP and are either anomalous or indicate the effect of an algaecide. Assuming that a CuSO4-based algaecide was applied during the period of measurements, the effectiveness of the algaecide can be seen by plotting the relationship between Chla and sulfate (SO4) concentrations, and this relation-ship is shown in Figure2. It is apparent from Figure2 that algae concentrations decrease signi"cantly with

Figure2: Chlorophyll-a levelsintheCCSsulfateconcentrations

increasingconcentrationsofalgaecide(asmeasuredbysulfateconcentration),indicatingthatadditionofan algaecideisaneffectivemeansofreducingalgaeconcentrationsintheCCS.However,itshouldalsobekept inmindthatChla reductionscausedbyanalgaecidearenecessarilyonlytemporary,sincethenaturalfactors causinghighlevelsofChla (i.e.,S,T,andTP)remainatelevatedlevelswithintheCCS.Sincethesystemis autotrophic, reduction of autochthonous TP levels should be targeted to ultimately reduce both algae levels andtheneedforrepeatedapplicationofalgaecide(s)intheCCS.

Impact of increased algae concentrations. It has been asserted (SFWMD, 2015) that increased algae concentrations and turbidities associated with algae blooms cause more solar energy to be absorbed in the CCS, and reduces the ability of the CCS to dissipate thermal energy. The primary mechanisms by which the CCS dissipates thermal energy are by evaporation and the emission of longwave radiation. A conventional assumption made by engineers and scientists is that the evaporation rate from a water body is unaffected by the concentration of algae in the water body. There is no scienti"c evidence documented in any published studies showing that the rate of evaporation from a water body is reduced by high algae concentrations. Further, there are no published studies showing that the emission of longwave radiation fromawaterbodyisparticularlysensitivetotheconcentrationofalgaeinthewater. Asaconsequence,the primary effect of increased algae concentrations in the CCS can be assumed to be increased absorption of solar radiation, which would increase the heating of the water and elevate the temperature of the water in theCCS.ThequantitativeeffectofincreasedsolarheatingoftheCCSduetoincreasedalgaeconcentrations isparameterizedbyareducedalbedoofthewatersurface, andtherelationshipbetweenthereducedalbedo and the corresponding increased temperature was investigated in this study using a heat-balance model described subsequently in Section 2.2 of this report. It should be noted that the trapping of solar energy due to increased algae concentrations would be moderated by the resulting increased evaporation which wouldcauseincreasedcoolingduetotheextractionofthelatentheatofvaporization.

Exhibit 17

12

1.5 SaltwaterIntrusion TheinlandextentofsaltwaterintrusionintheBiscayneAquiferisde"nedbythelocationofthe1000mg/L isochlor. As a reference concentration, the South Florida Water Management District (SFWMD) de"nes seawater as having a chlorinity (i.e., chloride concentration) greater than 19,000mg/L, and saline water as having a chlorinity greater than 250mg/L. Surface waters with chlorinities greater than 1500mg/L are classi"ed as marine waters, and surface waters with chlorinities less than 1500mg/L are classi"ed as fresh waters (F.A.C.62-302.200). The landward extent of the saltwater interface (i.e., the 1000mg/L isochlor) varies naturally in response to a variety of factors, such as seasonal variations groundwater recharge and variations in rates at which groundwater is pumped from the aquifer. For example, prolonged droughts or excessivewaterusageinlandthatreducewater-tableelevationscancauseincreasedsalinityintrusion. Prior to the construction of the CCS, the groundwater underlying the Turkey Point site was naturally saline due to the proximity of the site to the coast. In fact, had the groundwater not been saline, construction of the cooling-canalsystematTurkeyPointwouldnothavebeenpermitted. Sincethewater-tablegradienttowards thecoastatTurkeyPointistypicallyverylow,andwiththelocationofthesaltwaterinterfacebeingpartially controlledbythosegradients,evenslightreductionsofthefreshwaterpiezometric-headgradientcancause substantiallandwardmovementofthesaltwaterinterface. Theoccurrenceoflandwardgradientsduringthe dryseasonpromotesinlandmovementofsalinegroundwater.

CCSimpactonsaltwaterintrusion. IthasalwaysbeenrecognizedthatconstructionoftheCCSwithout any mitigating salinity-control systems would cause the saltwater interface to move further inland. This expectation was based on the assertion that construction of a CCS containing saline water one mile inland from the coast is tantamount to moving the coast one mile inland, and also moving the associated saltwater wedge around one mile inland. Since water in the CCS has a higher salinity than seawater, and is therefore denserthatthewaterinBiscayneBay,theeffectoftheCCSisactuallygreaterthanmovingthecoastonemile inland. Tocompoundthiseffect,theengineeringconsultantsthatoriginallyanalyzedtheperformanceofthe CCSalsoassertedthatifthewaterlevelintheCCSweretobeincreasedby0.50ftabovethepreconstruction water-tableelevation,thenthetoeofsaltwaterwaterwedgeatthebaseoftheBiscayneAquifermightmove approximately7.5milesfurtherinlandduringthedryseasonascomparedtoitsoriginallocationduringthe dry season. The engineering consultants also asserted that in the wet season, an elevated water level of 0.50ftintheCCSmightmovethetoeofthesaltwaterwedgeapproximately1milefurtherinlandcompared to its original location during the wet season. Based partially on these expectations, the salinity-control system that is currently in place was designed to control the westward migration of saltwater originating in the CCS. This control system involves pumping water from a so-called interceptor ditch into the CCS in order to create a seaward hydraulic gradient between the L-31E Canal and the interceptor ditch, where the L-31E Canal is located to the west of the interceptor ditch. The protocol for operating this salinity-control systemandtheeffectivenessofthesystemarediscussedinSection1.6ofthisreport.

Tracing the movement of CCS water in the Biscayne Aquifer. Tritium has been selected by the cog-nizant regulatory agencies (SFWMD and DERM) to trace the movement of CCS water in the Biscayne Aquifer. Historicaldatafrom1974to1975showedCCStritiumconcentrationsintheCCStobeintherange of1556-4846pCi/L,andreportssubmittedbyFPLforthemonitoringperiodfromJune2010throughDe-cember2011showedCCStritiumconcentrationsintherangeof1260-14,280pCi/L.Naturalgroundwater at the base of the Biscayne Aquifer would be expected to have relatively low concentrations of tritium. A threshold concentration of 20pCi/L has been used as a baseline to infer the presence of groundwater orig-Exhibit 17

13

inating from the CCS. Groundwater with concentrations below 20 pCi/L are presumed not to be affected by the CCS. FPL does not concur with the selection of 20 pCi/L as a threshold or background tritium con-centration for surface water, pore water, or shallow groundwater. The basis of FPLs contention regarding the20pCi/Lthresholdisthatmultiplefactorssuchasatmosphericdeposition,vaporexchange,anderrorsin laboratory analysis can in"uence reported tritium levels. The FPL assertion is reasonable and is supported bymeasureddatathatindicateatmosphericandvaporexchangeeffectsontritiumconcentrationscanbepar-ticularly signi"cant in surface water and shallow groundwater, with signi"cance decreasing with distance from the CCS. However, at depth, the CCS appears to be the primary source of tritium, and using tritium as a tracer in the lower elevations of the Biscayne Aquifer is reasonable. Reported measurements show groundwater tritium concentrations in excess of 3000pCi/L near the CCS, with concentrations decreasing withdistancefromtheCCS,andfoundatconcentrationsofhundredsofpCi/LthreemileswestoftheCCS at depth. The approximate limit of the 20 pCi/L concentration contour is 3.8-4.7mi west of the CCS and 2.1mieastoftheCCS.Basedonthestrengthofthesedataandsupportinganalyses,itisreasonabletocon-clude that operation of the CCS has impacted the salinity of the Biscayne Aquifer within the limits of the 20pCi/Lcontour.

1.6 L-31ECanalandInterceptorDitch L-31ECanal LeveeL-31Eanditsadjacent20-ftdeepborrowcanaltothewestoftheleveewereprimarily constructedasabarriertopreventsalinityintrusiontolocationswestofthecanal. TheL-31ECanalcollects water from other drainage canals in the area that include Military Canal, North Canal, Florida City Canal, North Model Land Canal (C-106), and South Model Land Canal (C-107). The L-31E Canal discharges into Biscayne Bay through structures S-20 and S-20F in the vicinity of Turkey Point. The L-31E Canal was constructed in the late 1960s by the U.S. Army Corps of Engineers and the Central and Southern Florida Flood Control District (CSFFCD), where the CSFFCD was later renamed the South Florida Water ManagementDistrict(SFWMD).

Interceptor ditch control system. The interceptor-ditch (ID) salinity-control system was designed to preventtheseepageofwaterfromtheCCSwestwardwithintheBiscayneAquifer. TheID,whichislocated immediatelytothewestoftheCCS,isoccasionallypumpedtocreateaseawardwater-tablegradientbetween the L-31E Canal to the west and the ID to the east, with the basis for the effectiveness of the ID control systembeingthatgroundwateroriginatingintheCCSwillbepreventedfrommigratingtowardsthewestin the presence of an eastward water-table gradient between the L-31E Canal and the ID. The ID is pumped whenanaturalseawardwater-tablegradientbetweentheL-31ECanalandtheIDdoesnotexist,andusually this is needed only during the dry season (November-April). The ID is adjacent and parallel to cooling-canalnumber32(CC-32)atthewesternendoftheCCS,andwasconstructedatthesametimeastheCCS.

TheIDisapproximately18-20ftdeep,30ftwide,and29,000ft(5.5mi)long. WithintheIDaretwopump stations, with each station containing two pumps, each capable of pumping up to 15,000gpm (21.6mgd).

There is no mechanism to transfer water between the ID and CCS, except for the 4 pumps at the two pump stations. The L-31E Canal, ID, and CC-32 are all approximately parallel to each other and run at an angle ofapproximately1738 westofsouth. TheperpendicularhorizontaldistancebetweentheL-31ECanaland the ID is about 1000ft. When the ID is pumped, there is a quick and measurable response in water levels in the L-31E Canal and the monitoring wells closest to the ID, indicating that there is good connectivity betweentheID,L-31ECanal,andnearbymonitoringwells.

Exhibit 17

14

Interceptorditchoperatingrule(1973-2011). TheIDoperatingrulethatwasfollowedfromtheinitial dateofoperationoftheCCSinFebruary1973upuntilDecember2011(i.e.,for38years)wasasfollows:

  • Whenever the water-surface elevation in the L-31E Canal is more than 0.2ft higher than the water-surfaceelevationinCC-32,thereisaseawardwater-levelgradientandnopumpingisnecessary.
  • Iftheabovecriterionisnotmet,aseawardgradientisstilltakentoexistifthewater-surfaceelevation in the L-31E Canal is more than 0.3ft higher than the water-surface elevation in the ID. Under this conditionnopumpingisnecessary.
  • If neither of the above two criteria are met, pumping of the ID is initiated and the pumping rates are adjustedtomeetthe0.3-ftwater-leveldifferencecriterionbetweentheL-31ECanalandtheID.
  • Pumpingisterminatedwhenthecriteriaforanaturalwater-tablegradientismet(withoutpumping).

Althoughthisoperatingruleisnolongerineffect,itisstillrelevanttothisanalysissincepossiblewestward migrationofsalinewaterfromtheCCSintotheBiscayneAquifercouldhaveoccurredwhilefollowingthis operatingrule. Thisconcernisdiscussedsubsequently.

Interceptor ditch operating rule (2011-present). A more conservative revised operating rule for the ID was initiated in December 2011 that considered freshwater piezometric-head equivalents rather than measured water-table elevations. This resulted in changes to the ID operating rule, and since December 2011theIDoperatingruleineffectisasfollows:

  • If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is equal to or greaterthan0.30ftthennopumpingofIDisnecessary,andaseawardgradientexists.
  • If the L-31E Canal water-surface elevation minus the CC-32 water-surface elevation is less than 0.30ft, a natural seaward gradient might still exist if the L-31E Canal water-surface elevation mi-nus the ID water-surface elevation is equal to or greater than 0.30ft and the density of the water in the ID is less than or equal to 1012kg/m3. If a density in the ID is greater than 1012kg/m3, a higher elevation difference between L-31E and the ID is necessary and can be calculated by converting the surface-waterlevelstofreshwaterpiezometric-headequivalents.
  • If a natural seaward gradient does not exist, create an arti"cial seaward gradient by pumping the ID untiltheIDismaintainedatanelevationdifferenceofatleast0.30-0.70ftbetweentheL-31ECanal andtheID,dependingonthedensityoftheIDwater.

Theprimarychangebetweenthisrevisedoperatingruleandthepreviousoperatingruleistheincreaseinthe L-31E/ID/CC-32water-leveldifferencecriteriaandtheconsiderationofvariable-densityeffects. Theuseof freshwaterpiezometric-headequivalentsprovidesamorerigorousapproachtotheoperationoftheID.

Effectiveness of the ID salinity-control system. Both the current and previous operating rules of the ID salinity-control system have limited salinity-control effects and do not prevent the landward migration of saline water originating from the CCS under all conditions. Following either of these operating rules, pumpingoftheIDreducesthewaterlevelintheIDbelowthatintheL-31ECanaltherebycreatingaseaward water-tablegradientandpresumablyprecludingwestwardmigrationofgroundwateroriginatingintheCCS.

However,pumpingwaterfromtheIDintotheCCSgenerallyelevatesthewater-surfaceintheCCSanditis Exhibit 17

15

possible for the water level in the CCS to be above the water level in the L-31E Canal, which then creates thepossibilitythatwateroriginatingintheCCScouldpassundertheIDevenwhenthepumpsintheIDare running to prevent this occurrence. Interestingly, this scenario was recognized in an early report prepared by the design engineers (Dames and Moore, 1971) based on results derived from an analog model of the system. Theanalogmodelshowedthatwestwardmigrationofthesaltwaterinterfaceispossibleevenifthe IDoperatingruleisfollowed. Further,Golder(2008)statedthatoperationoftheIDsalinity-controlsystem would prevent westward migration of CCS water at least in the top 18ft of groundwater. Measurements taken during ID pumping have in fact shown several occurrences where the water level in the CCS exceeds that in the L-31E Canal during ID pump operation, thereby indicating the possible ineffectiveness of the IDsalinity-controlsystem. Inactuality,thefunctioningoftheIDsalinity-controlsystemismoreaccurately characterizedasinterceptingshallowsalinegroundwateradjacenttotheIDthatisthenpumpedbacktothe CCS when the natural gradients are low and the potential for saltwater intrusion exists. It is possible that pumpingoftheIDundersomecircumstancessimplycreatesashallowsubsurface(groundwater)circulation in which water from the CCS "ows into the ID as groundwater that is subsequently returned to the CCS as pumped water. In support of this assertion, time series plots show that there are periods during pumping of the ID when the bottom-water temperatures in the ID rose along with an increase in speci"c conductance in the ID (Ecology and Environment, Inc., 2014). Aside from concerns regarding the effectiveness of the ID control system in mitigating saltwater intrusion, secondary concerns have also been raised that the ID control system contributes to the deterioration of groundwater quality in that it generally pumps less-saline waterfromtheIDintothehypersalineCCSwhichfurthercontributestoincreasedsalinityintheaquifer.

2 TemperatureVariationsintheCoolingCanals

The temperature in the CCS at the intakes to the power-generating units affect the ef"ciency and power output of the generating units that use water from the CCS. Both the ef"ciency and the power output of the generating units decrease with higher cooling-water temperatures. The practical upper limit of the intake cooling-water temperature is determined by the characteristics of the condensers and auxiliary heat exchangers in the generating units. In 2014 the Nuclear Regulatory Commission granted FPLs request to increase the maximum intake cooling-water temperature from 100F to 104F (37.8C to 40C). If the intakecooling-watertemperaturesintheCCSweretoexceed104F,thenFPLwouldberequiredtoreduce power output and possibly shut down one or more of the power-generating units. Since this occurrence wouldadverselyaffectalargenumberofcustomersintheSouthFloridaserviceregion,Miami-DadeCounty is obliged to work with FPL to "nd ways to avoid cutbacks in power generation resulting from elevated temperaturesintheCCS.

2.1 ResultsfromPreviousStudies 2.1.1 TemperaturesintheCCS Water temperatures in the CCS are almost always higher than synoptic temperatures of the overlying air, andtemperaturesintheCCSarealmostalwayshigherthantemperaturesinnearbyBiscayneBay. Analyses done by FPLs engineering consultants in around 2008 anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 2:5 F (1.4C) in the cooling water discharged to the CCS and an increase of 0:9 F (0.5C) in the temperature of the intake water (reported in SFWMD, 2008). These temperature changes were predicted to result in an increase in evaporation from the CCS of around 2-Exhibit 17

16

3mgd, and the increased evaporation was expected to increase the salinity in the CCS by 2-3. In contrasttotheaforementionedpredictions,ithasbeengenerallyreportedthattemperaturesintheCCShave actually increased by 5-9F (3-5C) in the post-uprate period compared with the pre-uprate period. In the summer of 2014 (during the post-uprate period), temperatures in the CCS were suf"ciently elevated as to prompt concern regarding the sustainability of the CCS as an adequate source of cooling water to the power-generatingunits. AccordingtoFPLsconsultant(EcologyandEnvironment,Inc.,2014),theincrease in CCS water temperatures in the post-uprate period cannot be attributed to the uprate since the total heat rejection rate to the CCS from Units 1, 2, 3, and 4, operating at full capacity prior to the uprate would have been higher than the post-uprate heat rejection rate to the CCS for Units 1, 3, and 4, operating at full capacity. Unit2 in the post-uprate period has been dedicated to operate in a synchronous generator mode andhencenotproducingsteamheat.

2.1.2 ThermalEf"ciencyoftheCCS Thethermalef"ciencyoftheCCSisameasureoftheabilityoftheCCStocoolthedischargedwaterdown to the background air temperature. An investigation of the thermal ef"ciency of the CCS was performed by Lyerly (1998), and these analyses indicated that the thermal ef"ciency of the CCS at the time of the study was equal to 86.4%. This ef"ciency was based on a 24-h average discharge temperature of 107 :3 F (41.8C),averageintaketemperatureof91:1 F(32.8C),andanaverageairtemperatureof88:6 F(31.4C).

In analyzing the temperature measurements, Lyerly (1998) noted that most of the cooling (i.e., most of the temperature decrease) occurs as the water in the CCS "ows from the (north) discharge location to (south) collector canal, with much less temperature decrease as the water "ows back from the collector canal to the (north) intake location. It is expected that the thermal performance varies with "ow rate and the state of the CCS, so the reported thermal ef"ciency should be regarded more as a snapshot of conditions at the timeofthemeasurementsthanasaconstantvalue. MorerecentmeasurementsbetweenJune2010andJune 2012 (Ecology and the Environment, 2012) show water temperatures in the CCS on the discharge side of the power-generating units being around 13.5F (7:5 C) warmer on average than at the intake side of the power-generatingunits. TheaveragetemperatureatthesouthendoftheCCSwasonly2F(1:1 C)warmer than at the intake side of the power-generating units, which supports the assertion that most of the cooling intheCCSoccursasthewater"owsfromnorthtosouth.

2.1.3 ThermalEffectsonGroundwater Measured groundwater temperatures in some wells between the ID and the L-31E Canal show higher tem-peratures than the groundwater west of the L-31E Canal, and this occurrence has been partially attributed tolimitedcooling-canalwaterintrusion(DamesandMoore,1977). Agroundwaterthermoclinehasbeen reported to exist in the area west of the CCS, which shows a sudden decrease in groundwater temperature at a particular depth in the aquifer. Measurements show that nearly all of the seasonal temperature "uc-tuations occur above an elevation of 25 ft NGVD. Below 25 ft NGVD, the groundwater temperature generally remains in the range of 75F-77F (24C-25C). The seasonal temperature "uctuations above

25 ft NGVD have been attributed to the heating and cooling of water in the L-31E Canal in response to seasonal changes in atmospheric conditions. Notably there is some temperature strati"cation in the L-31E Canal, in part due to the canal depth and limited "ow. The near-surface water temperatures in the L-31E Canal are almost always warmer than the bottom temperatures, and the surface temperatures exhibit more daily variability in response to air temperature changes. Aside from the groundwater adjacent to the L-31E Exhibit 17

17

Canal, it has also been reported (Ecology and Environment, Inc., 2014) that since groundwater in monitor-ing wells TPGW-2M and TPGW-2D is warmer than other nearby surface waters such as Biscayne Bay or fresh groundwater, the CCS might be in"uencing the groundwater temperatures in those wells. Based on the aforementioned evidence, it can be concluded that the environmental effects of elevated groundwater temperaturesduetotheoperationoftheCCSareinconsequential.

2.2 Heat-BalanceModelofCCS To fully understand the temperature dynamics in the CCS, it is necessary to have a validated heat-balance model of the CCS. In reviewing the documentation made available for this investigation, all indications werethatsuchamodeldoesnotcurrentlyexist,atleastnotinthepublicdomain. Historicaldocumentation shows that a heat-balance model was developed in the early stages of operating the CCS, as reported by Ray L. Lyerly Associates (1973), however, utilization of this model has not been subsequently reported.

As described by Lyerly (1973), the heat-balance model that was developed previously took into account such key components as the heat entering the water from the power-generating units, the net heat entering the water from shortwave solar radiation and longwave atmospheric radiation, and the latent heat transfer associated with evaporation. The input variables in the thermal model were the air temperature, relative humidity, wind velocity, and the net amount of radiation; the output variable was the water temperature in theCCS.

2.2.1 Heat-BalanceModelFormulation To investigate and understand the thermal dynamics within the CCS, a preliminary heat-balance model of the CCS was developed for this study. The CCS was divided into four zones as shown in Figure 3, where water in the CCS "ows sequentially through zones 1, 2, 3, and 4. The four delineated zones are the same

Figure3: Cooling-canalsystem

zones that are used in salinity-balance model of the CCS developed by the engineering consultant for FPL.

Exhibit 17

18

The measurement stations that characterize conditions within each of the four CCS zones were taken as TPSWCCS-1, TPSWCCS-2, TPSWCCS-4, and TPSWCCS-5, respectively, and the approximate locations of these measurement stations are shown in Figure 3. The average-daily temperature measurements within each of the CCS zones in the period 9/1/10-12/7/14 are shown in Figure 4. It is apparent from these

Figure4: TemperaturemeasurementsinCCS

measurements that the temperatures in the CCS decrease noticeably from zones 1 to 3 (i.e., moving from north to south in the CCS), with much less temperature change as the water moves back to the northern (cooling-waterintake)endoftheCCSthroughzone4. Therefore,almostallofthecoolingintheCCSoccurs in the south-"owing canals in the western portion of the CCS. It is further apparent from the temperature measurementsshowninFigure4thatthemidsummertemperaturesin2014(betweenJulyandAugust)were higher than the midsummer temperatures in previous years. For the period of record (9/1/10-12/7/14), the maximummeasureddaily-averagetemperatureinZone1was113F(44.9C)recordedon8/21/14,andthe maximum measured daily-average temperature in Zone 4 was 101F (38.3C) recorded on 8/22/14. Since the maximum allowable temperature at the cooling-water intake is 104F and measured temperatures in Zone 4 have been close to this limiting value (e.g., 101F recorded on 8/22/14), there is cause for concern.

Temperatures in Zone 4 near the 104F limit could force curtailment of power generation by one or more of the power-generating units, and cause power outages in South Florida. Given the elevated temperatures thathavebeenrecordedintheCCS,isnecessarytoidentifythefundamentalreasonsfortheseoccurrences, and to determine whether such occurrences are expected to continue in the future without any changes in the CCS and/or power-plant operations. To fully understand the temperature dynamics in the CCS it was necessarytodevelopaheat-balancemodeloftheCCS,whichisdescribedinthefollowingsection.

2.2.2 Heat-FluxComponents Theheat"uxeswithineachoftheCCSzonesareillustratedinFigure5,wherethevolumetricin"owrateand temperatureareQ 1 andT 1,respectively,andthecorrespondingquantitiesontheout"owsideareQ 2 andT 2.

Withineachzone,thereareseveralsourcesofenergythatarerepresentedinFigure5. Theseenergysources

Inthisreportheatandthermalenergyareusedinterchangeably.

Exhibit 17

19

Figure5: Energy"uxesinCCSzone

andtheirquanti"cationaredescribedbelow,where,forconsistencywiththermodynamicconvention,energy addedtoCCSistakenaspositiveandenergylossesaretakenasnegative.

Absorbedsolarradiation,(1 )R s. Theincidentsolar(short-wave)radiationisrepresentedbyR s [EL2 T 1]§,

andthealbedo(i.e.,re"ectivity)ofthewatersurfaceisrepresentedby [dimensionless];thereforethe amount of solar radiation that is absorbed within the zone is (1 )R s. The average solar radiation, R s, for each day in the four-year study (9/1/10-12/7/14) was obtained from the Florida Automated WaterNetwork(FAWN)stationlocatedonthepremisesoftheUniversityofFloridaTropicalResearch and Education Center (TREC) in Homestead, Florida. The albedo, , of a water surface is typically on the order of 0.1 for latitudes in the range of 20 -30 (Cogley, 1979), and a value of 0.1 was used as a reference value for this investigation. Factors such as the concentration of algae in the CCS can affect the value of , and therefore the sensitivity of the temperature dynamics within the zone to elevated algae concentrations was investigated by varying . The minimum value of is equal to zero, in which case all of the incident solar radiation is absorbed by the CCS and none is re"ected.

Hence, wasvariedwithintherangeof0-0.1.

Evaporationheat"ux,E h. Evaporation extracts heat from the CCS due to the latent heat of evaporation required to transform water from the liquid phase to the vapor phase. The evaporation heat "ux, E h [EL 2T 1],isgivenby E h = E fL v (1) where E [LT1 ] is the evaporation rate, f [ML 3] is the density of fresh water, and L v [EM 1]

is the latent heat of vaporization of water. The evaporation rate of water has long been known to decrease with increasing salinity (e.g., Harbeck, 1955; Salhorta et al., 1985). In the present study, daily evaporation rates, E, were calculated based on typical salinities in the CCS, measurements of water temperature, T s [], at the monitoring station within the zone, onsite measurements of air temperature, T a [ ] and relative humidity, RH [dimensionless] at station TPM-1, and measurements of wind speed,V w, at station TD. The freshwater density, f, in Equation 1, was taken as 994kg/m3, which is the approximate density of fresh water at 35C (95F). The latent heat of vaporization, L v, in Equation 1, is known to depend on both the temperature and salinity of the source (liquid) water. At a temperature of 35C, values of L v at salinities of 60 and 80 are 2.279MJ/kg and 2.229MJ/kg,respectively(Sharqawyetal.,2010),andanaverageof2.254MJ/kgwasusedforL v in theenergyanalysis. TheempiricalformulausedforestimatingE [cm/d],fromonsitemeteorological

§Termsinsquarebracketsindicatedimensions: E=energy,L=length,M=mass,T=time,and =temperature.

Exhibit 17

20

measurementsis E = C w (0:299+0:11V w )l{z}[ es(T s) RHes(T a)] (2)

= f (V w )

whereC w [dimensionless]isacalibrationconstant,f (V w ) = C w (0:299+0:11V w ) isawindfunction thataccountsfortheeffectofwindonevaporation,V w isthewindspeedinm/s, [dimensionless]isa factorthataccountsfortheeffectofsalinityonthesaturationvaporpressureofwater,andes(T ) [kPa]

is the saturation vapor pressure of water at temperature T. Equation 2 was used to calculate the evaporation for the sake of consistency with the previously developed salinity model of the CCS, where the constants C w and were taken as 0.69 and 0.885, respectively. In the salinity model, the value of C w was determined by calibration, and the value of was obtained from previous research on evaporation from saline water bodies reported by Salhorta et al. (1985). The evaporation formula givenbyEquation2hasanuncertainfunctionalform,particularlyforthewindfunctionf (V w ).

Uncertainty in the wind function. Wind functions used to estimate evaporation typically havethe form f (V w ) = a + bV w, where a and b are constants. Such a wind function is used in Equation 2.

In arti"cially heated waters, vertical convection is particulary important under low-wind conditions making speci"cation of the value of a a key parameter. The wind function used in Equation2 was originally proposed by Williams and Tomasko (2009) for heated waters, however, alternate formula-tions have been proposed by others (e.g., Brady et al., 1969; Ryan and Harleman, 1973). Notably, theformulationproposedbyRyanandHarleman(1973),andsubsequentlysupportedbyAdamsetal.

(1975),accountsfortheeffectofthetemperaturedifferencebetweentheheatedwaterandtheoverly-ing air in specifying the convection parametera in the wind function, which is a logical relationship thatisnotaccountedforintheothermodels(includingthemodelusedinthisstudy)andcouldbean importantconsiderationinaccountingforconvectiveheattransferatlowwindvelocities.

Rainfallheat"ux,R h. Rainfall that is cooler than the water in the CCS extracts thermal energy from the CCS because thermal energy in the CCS water is used to warm the rainwater. The heat "ux, R h [EL2T 1]duetorainfalldirectlyontheCCScanbeestimatedusingtherelation

R h = fcp f d r(T s T r)

where f [ML3 ] and cp f [EM1  1] are the density and speci"c heat of the (fresh) rainwater, re-spectively,d r is the depth of rainfall,T s [ ] is the temperature of the water in the CCS, andT r [ ] is thetemperatureoftherainfall. TherearenodirectmeasurementsofrainfalltemperatureattheTurkey Point site, however, it can be estimated that during a rainfall event the ambient air can be cooled by several degrees, and the temperature of raindrops approaches that of the cooled ambient air. Cooling effects of rainfall on the ambient air have been reported to be as high as 10C (Byers, 1949). On a global average, raindrops can have temperatures in the range of 32F-80F (0C-27C). For pur-posesofthepresentanalysis,thetemperatureoftherainfall,T r,wasassumedtobe68F(20C),and thecorrespondingvaluesof f andcp f weretakenas998kg/m3 and4.180kJ/kg C,respectively. The temperature dynamics in the CCS zones are relatively insensitive to the assumed temperature of the rainfall.

Atmosphericlongwaveradiation,L a. Anybodyofmatterwhosetemperatureisaboveabsolutezeroemits longwaveradiation. Longwaveradiation,L a [W/m2]emittedbytheatmospherecanbeestimatedus-Exhibit 17

21

ingtherelation(Chin,2013)

L a = (T a +273) 4(0:6+0:031 RHes(T a)(1 R L )

where is the Stefan-Boltzmann constant (= 4:903  10 9 MJm 2K 4d 1), T a [C] is the air tem-perature,RH[dimensionless]istherelativehumidity,es(T a) [mmHg]isthesaturationvaporpressure of water at temperature T a, and R L is the longwave re"ection coef"cient that can be taken as 0.03.

On cloudy days, atmospheric longwave radiation can be the greatest source of thermal energy at the watersurface.

Waterlongwaveradiation,L w. Water in the CCS also emits longwave radiation by virtue of its temper-ature being greater than absolute zero. Longwave radiation, L w [W/m2] emitted by the water in the CCScanbeestimatedusingtherelation(Chin,2013)

L w = (T s +273) 4

where is the emissivity of water that can be estimated as 0.97 [dimensionless], is the Stefan-Boltzmannconstantasgivenpreviously,andT s [C]isthetemperatureofthewaterintheCCS.

Heatinterchangewithsurroundingaquifer,G h. The CCS exchanges heat with the surrounding aquifer via seepage of groundwater into and out of the CCS, and conduction of heat between water in the CCS and groundwater in the surrounding aquifer. It is to be expected that the region immediately surroundingtheCCSisnormallycoolerthanthewaterintheCCS,inwhichcasetherewillbecooling oftheCCSwaterduetoheatconductionbetweentheCCSandthesurroundingaquifer,coolingdueto seepage in"ow from the surrounding aquifer into the CCS, and no cooling or heating due to seepage out"ow from the CCS into the surrounding aquifer. The cooling heat "ux due to conduction can be assumed to negligible compared to the heat "ux due to seepage in"ow. The heat "uxG h [EL 2T 1]

duetoseepagein"owisproportionaltothetemperaturedifferencebetweenthewaterintheCCSand thegroundwaterinthesurroundingaquiferandcanbeestimatedbytherelation

G h = gcp g Q sgA s T sg

where g [ML3 ]andcp g [EM 1 1 ]arethedensityandspeci"cheat,respectively,ofthegroundwa-tersurroundingtheCCS,Q sg [L3T1 ]istheseepagein"owtotheCCSfromthesurroundingaquifer, A s [L2] is the area of the CCS zone, and T sg [] is the difference between the temperature in the CCS,T s [ ],andthetemperatureonthesurroundinggroundwater,T g [](i.e., T sg = T s T g)

Conductionheat"ux,C h. The conduction heat "ux is associated with the sensible transfer of heat be-tween the CCS water and the air above the CCS. The conduction heat "ux, C h [W/m2] can be esti-matedusingtheempiricalrelation(Chin,2013;Chapra,1997)

C h = c B f (V w )(T s T a)

wherecB isBowenscoef"cient,and f (V w ) isthewindfunctionasde"nedinEquation2. Following the guidance given in Chin (2013) and Chapra (1997), the value of cB can be estimated as 0.063.

According to Martin and McCutcheon (1998), sensible heat transfer from lakes and reservoirs to the overlying air due to conduction and convection is a relatively small component of the heat balance Exhibit 17

22

equation that is poorly understood, and Brown and Barnwell (1987) have noted that the conduction heat "ux from lakes and reservoirs to the overlying air calculated by heat-transfer theory is normally small enough to neglect. Given the aforementioned considerations, conduction of heat between the CCSandtheoverlyingairwasneglectedinthisanalysis.

Based on the component heat "uxes described above, the net heat "ux, _H C [EL2 T 1], into the CCS is givenby 4{ }

_H C = [(1 )R s + E h + R h + L a + L w + G h ]i A i (3)

i=1 wherei isanindexthatreferstoeachzonewithintheCCS,A i [L2]istheareaofZonei,andthesummation isoverthefourzoneswithintheCCS.TheareasofeachofthezonesintheCCSaregiveninTable1,andthe total area of the CCS is approximately 1907ha (= 4712ac). The heat extracted from the CCS by pumping

Table1: CCSZonalAreasinEnergyandSalinityModels

Area Zone (ha) 1 368.0 2 795.1 3 396.6 4 347.0 Total 1906.7

cooler water from the ID into the CCS was calculated in a similar manner to the method used to calculate thecoolingeffectofrainfall,wheretheeffectiverainfallrateisequaltothevolumeofwaterpumpedfrom the ID divided by the area of the CCS. Assuming (conservatively) that the temperature difference between the ID water and the CCS water is 10C (50F), the cooling effect of pumped ID water was found to be negligiblecomparedwithothercomponent"uxesintheheat-balanceequation.

2.2.3 Heat-BalanceEquations Under steady-state conditions, conservation of thermal energy requires that the net rate at which heat is added to the CCS is equal to the difference in thermal energy between the water leaving the CCS and the waterenteringtheCCS.Thisrelationshipisexpressedbythefollowingequation,

_H C = scp sQ (T 4 T 1) (4)

where s andcp s are the density and speci"c heat of the CCS water,Q is the "ow rate of water through the CCS, T 4 the temperature of the cooling water at the intake of the power plant (in Zone 4), and T 1 is the temperatureofthecoolingwateratthedischargefromthepowerplant(inZone1). Ifthepower-generating unitsaddheattothewateratarate _H G,thenbetweentheintakeanddischargeendofthepower-generating unitstheheat-balanceequationisgivenby

_H G = scp sQ (T 1 T 4) (5)

Exhibit 17

23

Combining Equations 3, 4, and 5 requires that the heat rejection rate in the power-generating units, _H G, is relatedtothenetrateatwhichheatisaddedtotheCCS, _H C,bytherelation

4{ }

_H G = [(1 )R s + E h + R h + L a + L w + G h ]i A i (6) i=1

This equation can be used to estimate the heat-rejection rate, _H G, of the power-generating units based on "eld measurements that are used to calculate the terms on the righthand side of Equation 6. In cases where daily time steps are used, estimated values of _H G might "uctuate about a mean value and be dif"cult to discern. Insuchcases,theaverageheat-rejectionrate, _H G J,overaperiodofJ timestepscanbeestimated usingtherelation J

_H G J = 1J t_H G t (7) j=1 where t is the duration of each time step. In accordance with Equation 7, a constant heat rejection rate canberecognizedbyplottingthecumulativeestimatedheatrejectionrate, Jj=1 _H G t,versustime, J t, which would would result in a straight line of constant slope equal to _H G J. This relationship was used in this study to identify periods of constant heat rejection rate of the power-generating units that utilize the CCS.

2.2.4 ModelResults The heat-balance model was applied to each of the four zones within the CCS to determine the net heat "ux into each zone, and the results from all zones were combined to determine the net heat "ux into the entireCCS.Theenergymodelwasappliedatdailytimestepsfortheperiodofrecord9/1/10-12/7/14. The thermal-energy dynamics within each of the CCS zones are similar, and the "uctuations of the heat-"ux componentsinZone1willbeusedtodemonstratethethermal-energydynamicswithineachzone.

Zone1heat-"uxcomponents. Thelongwaveradiationandshortwavesolarenergy"uxesasafunctionof time are shown in Figure 6(a), and the evaporation and rainfall heat "uxes as a function of time are shown in Figure 6(b). It is apparent that the shortwave and longwave energy "uxes vary seasonally, and that there

Figure6: Energy"uxesinZone1 Exhibit 17

24

is much more seasonal variation in the shortwave solar radiation than in the longwave radiation. The net longwave radiation has a cooling effect (i.e. net negative heat "ux) which contributes to a net-radiation coolingoftheCCSwateratnightwhenthesolarradiationiseffectivelyzero. ItisapparentfromFigure6(b) that evaporation and rainfall generally have a cooling effect, with evaporation usually having the greater coolingeffectandrainfallhavingalessercoolingeffect. Theconvectiveheat"uxbetweentheCCSandthe adjacentgroundwater,G h,isnotshowninFigure6becausethemagnitudeofG h isgenerallymuchsmaller thattheheat"uxduetorainfallandthereforehasaminimalimpactontheheatbalancewithintheCCS.

Heat rejection rate of the power-generating units. To determine the thermal dynamics in the entire CCS, the component heat "uxes were determined for each zone within the CCS, and these heat "uxes were combined in accordance with Equation 6 to determine the thermal energy that is added to the CCS by the power plant (i.e., the heat-rejection rate). The cumulative heat-rejection from the power plant as a function of time for the entire CCS is shown in Figure 7. It is apparent from Figure 7 that there are two

Figure7: Cumulativeheatrejectionratefromthepowerplant

periodsduringwhichtheheatrejectionrateisapproximatelyconstant. The"rstperiod,shownasPeriod1in Figure 7, covers the time interval 9/1/10-2/1/13, and the second period (Period2) covers the time interval 7/1/13-12/1/14. Notably, Period1 includes the pre-uprate period before May 2013 and Period2 includes the post-uprate period after May 2013. During Period1, the average heat-rejection rate is estimated to be around 2800MW, and during Period2 the average heat-rejection rate is estimated to be around 5500MW.

Although these estimated heat rejection rates are preliminary estimates and derived from an uncalibrated heat-balance model, the distinct difference in heat-rejection rates between the two periods is clear, and the numerical estimates of the heat-rejection rates during these two periods are reasonable given the capacities ofthepower-generatingunitsservicedbytheCCSandtheenergyef"cienciesnormallyassociatedwithboth fossil-fuelandnuclearpowerplants. AlogicalinferencefromtheresultsshowninFigure7isthattheuprate inpower-generatingcapacityofthetwonuclearunits(Units3and4)hascausedthetotalheat-rejectionrate from the power plant to increase signi"cantly. This "nding is not inconsistent with the condition that the post-uprate generating capacity of the power plant served by the CCS is less than the pre-uprate generating Exhibit 17

25

capacity (due to Unit2 operating in synchronous generator mode). This is so because in the post-uprate generating capacity there is a signi"cant shift from fossil-fuel generation to nuclear-power generation, and nuclear-power units are known to have a much higher heat-rejection rates to cooling water than fossil-fuel generatingunits,whichreleaseasigni"cantportionoftheirwasteheatin"ue-gasemissions.

Effect of algae. It is assumed that the algae content of the CCS affects the heat balance in the CCS by increasing the amount of solar energy that is absorbed by the CCS. Consequently, the effect of algae in the CCS was investigated by reducing the albedo (i.e., re"ectivity), , of the water surface from 0.1 to 0.0 starting on January 1, 2014. An albedo of 0.1 was used in the normal simulations presented in Figure7sincethisisthetypicalvalueof thatisassociatedwithwatersurfacesatsubtropicallatitudes;this corresponds to 90% of the incident solar radiation being absorbed by the water in the CCS. Assuming that the effect of algae is to retain more solar heat, then taking = 0 re"ects the extreme case where the CCS with high concentrations of algae absorbs 100% of the incoming solar radiation. The effect of reducing from 0.1 to 0.0 on the estimated cumulative heat-rejection rate is shown in Figure 8. It is apparent that the

Figure8: Estimatedalgaeeffectonestimatedcumulativeheatrejectionratefromthepowerplant

impactofthehigherabsorptionrateofsolarenergyattributedtohighalgaeconcentrationsisrelativelysmall comparedwiththeheatrejectionrateofthepower-generatingunits. Inquantitativeterms,theincreasedrate ofheatingoftheCCSduetoreducedre"ectionofsolarenergyisaround400MW,comparedwithanormal heat rejection rate of around 5700MW (in 2014). This indicates that the (maximum) rate of increased heating caused by algae is only around 7% of the normal heat-rejection rate, and hence there is a relatively smallheatingeffectcausedbyalgaeintheCCS.

Relationshipbetweenincreasednetheat"uxandtemperature. Anincreasedheat-rejectionratewould be expected to increase the temperature in the CCS relative to the temperature of the overlying air. Repre-senting the temperature in the CCS as T s, and the temperature of the overlying air as T a, this temperature differenceisT s T a. ThevariationofT s T a asfunctionoftimeforeachofthefourCCSzonesisshown Exhibit 17

26

in Figure 9, where the average temperature difference during Period1 and Period2 are shown as horizon-tal lines. It is apparent from Figure 9 that the increase in the average heat-rejection rate from Period1 to

Figure 9: Temperature differences between CCS and overlying air. Horizontal lines show intervals of con-stantheat-additionrates.

Period2 corresponds to an increase in the average value of T s T a. Representing the average value of T s T a during Period1 asT 1 and the average value ofT s T a during Period2 asT 2, these averaged values for each CCS zone are shown in Table2, along with the corresponding standard deviations, S 1 and S 2, respectively. These results show that in Zone1, which accepts the cooling-water discharge, the average temperature difference between the CCS and the overlying air has increased from 9.6C (18F) to 13.1C (23.6F), which corresponds to an average temperature increase of 3.5C (6.3F). In Zone4, which con-tains the cooling-water intake, the average temperature difference between the CCS and the overlying air has increased from 2.8C (5.0F) to 5.4C (9.7F), which corresponds to an average temperature increase of 2.6C (4.7F). These changes in average temperature can be contrasted with previous (pre-uprate) pre-dictions made by FPLs engineering consultants in 2008 where it was anticipated that the uprate of Units 3 and 4 would cause a maximum temperature increase of 1.4C (2.5F) in the discharged cooling water (to Zone1)andanincreaseof0.5C(0.9F)inthetemperatureoftheintakewater(fromZone4). Thestandard deviations of the temperature "uctuations are similar across all zones, and have shown relatively modest decreases between the pre-uprate and post-uprate periods. Of particular interest, in Zone1 the standard de-viationdecreasedfrom3.8C(6.8F)to3.3C(5.9F),andinZone4thestandarddeviationdecreasedfrom 3.9C(7.0F)to3.5C(6.3F).

Exhibit 17

27

Table2: TemperatureStatisticsinCCS

Period1 Period2 T 1 S 1T 2 S 2 T 2 T 1 Zone (C) (C) ( C) ( C) ( C) ( F) 1 9:6 3:8 13:1 3:3 3 :5 6:3 2 4:6 3 :7 8:4 3:7 3 :8 6:8 3 2:9 3 :9 5:5 3:6 2 :6 4:7 4 2:8 3 :9 5:4 3:5 2 :6 4:7

Thermal ef"ciency. The thermal ef"ciency, t, of the CCS is a measure of the ability of the CCS to cool the water down to the background air temperature. The thermal ef"ciency of the CCS was previously measuredbyLyerly(1998)usingtherelation

t = 1 T i T aT d T a (8)

where T d and T i are the temperatures of the cooling water at the discharge and intake ends of the power plant, respectively, and T a is the temperature of the ambient air above the CCS. The thermal ef"ciency of theCCScanbeestimatedusingEquation8byreplacingT d T a bytheaveragevalueofT s T a inZone1, andreplacingT i T a bytheaveragevalueofT s T a inZone4. Usingtheaveragedtemperaturedifferences giveninTable2inEquation 8gives:

Period1: t = 1 2:89:6 = 0:71; Period2: t = 1 5:413:1 = 0:59

These results indicate that the thermal ef"ciency of the CCS in Period1 is around 70% and the thermal ef"ciency of the CCS in Period2 is around 60%. Hence, the thermal ef"ciency of the CCS has apparently decreased between Period1 and Period2. The reason for this decrease in thermal ef"ciency is not readily apparent and could be due to a variety of factors, including increased thermal loading and increase algae concentrations in the CCS. It should be noted that the thermal ef"ciency of 86% reported by Lyerly (1998) is not directly comparable to the values calculated here, since the additional cooling between the discharge location and the Zone1 temperature measurement station, as well as the additional cooling between the intake location and the Zone4 temperature measurement location are not taken into account in the present analysis.

2.2.5 Conclusions The results derived from the heat-balance model indicate that the rate of heat addition to the CCS has in-creased signi"cantly during the period of record, and that the increased heat-addition rate is manifested in anincreaseintheaveragetemperatureintheCCSrelativetothetemperatureoftheoverlyingair. Itappears that the most likely cause for the increased heat-addition rate is an increased heat-rejection rate from the power-generating units. Notably, the increased heat-addition rate began shortly after the beginning of the post-uprate period. As a result of the increased heat addition to the CCS, the average temperature in the intakezone(Zone4)hasincreasedbyapproximately2.6C(4.7F). Interestingly,thismeasuredincreasein Exhibit 17

28

average temperature is slightly greater than the increase in the maximum allowable operating temperature at the intake location of 2.2C (4.0F)¶ approved by the Nuclear Regulatory Commission in 2014. There-fore, the increased maximum allowable operating temperature has not reduced the probability of the intake temperatures exceeding the threshold value, and might have slightly increased the probability of exceeding the threshold temperature. This serves as a cautionary note regarding further increases in power generation beyond 2014 levels without providing a supplementary system to cool the water in the CCS. Others have cited increased algae concentrations in the CCS as being as a possible reason for elevated temperatures of the water in the CCS. However, a sensitivity analysis indicates that changes in the algae-in"uenced solar re"ectivityoftheCCSwithinarealisticrangeareunlikelytohavebeenofsuf"cientmagnitudetocausethe observed changes in temperature, nor stimulate the sudden change in heat-addition rate that was observed almost immediately after the beginning of the post-uprate period. There are indications that the thermal ef"ciency of the CCS has decreased signi"cantly between the pre-uprate and post-uprate periods. Further investigation is recommended to con"rm this "nding and to identify the factor(s) causing the reduced ther-malef"ciency.

Limitationsoftheheat-balancemodel. Theheat-balancemodeldevelopedforthisstudyisbasedonthe best estimates of all of the heat-balance components that in"uence the temperature in the CCS. However, the heat-balance model has not been calibrated due to lack of available data for calibration. Data required to calibrate the heat-balance model would include synoptic measurements of the "ow rate and temperature differences between the intake and discharge structures of the power-generating units, and synoptic tem-peratures and "ow rates at the in"ow and out"ow faces of each CCS zone. Calibration of the heat-balance model would not necessarily change the key inferences that have been drawn from the uncalibrated model, namely that there has been a signi"cant increase in the heat-rejection rate from the power-generating units during the post-uprate period, and that increased algae concentrations and increased ambient temperatures are not the most likely causes of elevated temperatures in the CCS. Further development of a calibrated heat-balancemodeliswarrantedtocon"rmtheconclusionsthathavebeendrawn.

3 SalinityVariationsintheCoolingCanals

Salinityisde"nedasthemassofdissolvedsaltsperunitmassofsolution,andisusuallyreporteddirectlyin unitsofeitherpartsperthousand()orasadimensionlessnumberonthepracticalsalinityscale1978(PSS-78). Salinities are sometimes expressed indirectly in terms of chlorinity (mg/L chloride) or conductance (mS/cm). In this report, salinities are expressed in units of parts per thousand (), which gives salinities approximatelyequalinmagnitudetosalinitiesexpressedinPSS-78. Asreferencepoints,averageseawaterat 25Chasasalinityof35,achlorinityof19.84g/L,andaspeci"cconductanceof54.7mS/cm. Hypersaline water is typically de"ned as water with a salinity greater than 40 or a speci"c conductance greater than 61.5mS/cm, and brine is typically de"ned as water with a salinity greater than 50. These hypersalinity andbrinethresholdsareroutinelyexceededintheCCS,andthereforewaterwithintheCCScanbeproperly classi"edeitherasbeinghypersalineorasbrine.

¶From37.8 Cto40 C(100 Fto104 F)

Exhibit 17

29

3.1 ResultsfromPreviousStudies There has been a continuous upward trend in salinity since the CCS began operation in August 1973, and thistrendisclearlyapparentinFigure10,whichshowsthemaximumreportedsalinitiesintheCCSsincethe initialNPDESreportwassubmittedin1973. Thelong-termtrendofincreasingsalinityshowninFigure10

Figure10: MaximumobservedsalinitiesintheCCSsinceinitialoperation

canbeapproximatedasbeinglinear(asshownbythelineartrendline)withasalinityincreaseofaround5 per 10years. It is also apparent from Figure 10 that the rate of increase in salinity might have accelerated since 2013. The salinity in the CCS when it was "rst put into operation was around 26.5, with the contemporaneous salinity in Biscayne Bay being around 33 (Lyerly, 1973). The average CCS salinity in 1998 was reported to be in the range of 38-50 (Lyerly, 1998), and in May 2014, the salinity in the CCS wasreportedtobeashighas95.

Salinity-controlprocesses. ThekeyprocessesaffectingthesalinityintheCCSare: rainfall,evaporation, andgroundwaterexchangebetweentheCCSandthesurroundingaquifer. AverageannualrainfallatTurkey Pointisapproximately60inches,andthenaturalannualevaporationatTurkeyPointisapproximatelyequal to the average annual rainfall. Actual evaporation of water from the CCS exceeds natural evaporation due to the elevated temperatures in the CCS. The steady increase in salinity since operation of cooling canals beganintheearly1970s(asshowninFigure10)hasbeenmostcommonlyattributedtoevaporationexcess overrainfall.

3.1.1 HistoricalChlorideLevels Chlorideconcentrations(i.e.,chlorinities)intheCCSbetweenJune2010andJune2012wereintherangeof 26-46g/L with an average chlorinity of 33.9g/L. The average chlorinity in Biscayne Bay during the same period was 18.9g/L (Ecology and Environment, Inc., 2012). There is little difference (less than 10%) in chlorideconcentrationbetweensamplescollectednearthesurfaceornearthebottomatanygivensampling location within the CCS canals. Chloride concentrations in the CCS during the post-uprate period were observedin range of 27.0-49.8g/L, with the highest valuesobserved in March 2014 and the lowest values inJune2013(EcologyandEnvironment,Inc.,2014).

Exhibit 17

30

3.1.2 HistoricalSpeci"cConductanceLevels Speci"c conductances in the CCS between June 2010 and June 2012 were in the range of 70-90mS/cm.

Speci"cconductanceintheCCShasbeenrisingsincethebeginningofthedryseasonin2014andreached over 120mS/cm in May 2014. The average post-uprate speci"c conductance for all CCS stations was reported as 92.6mS/cm, and this average value was over 15mS/cm higher than the average value reported inthepre-uprateperiod.

3.2 Salinity-BalanceModelofCCS The salinity-balance model of the CCS that is currently being used to simulate salinity variations in the CCS was developed by engineering consultants for FPL. The salinity-balance model uses a "nite-control-volume approach in which the control volume is de"ned to include the canals of the CCS and the adjacent interceptor ditch (ID). The salinity-balance model is closely related to a companion water-balance model, withbothmodelshavingbeendevelopedbythesamecontractoranddescribedbyEcologyandEnvironment, Inc.(2012). Forpurposesofthecurrentanalyses,thispreviouslydevelopedmodelwillbeacceptedasvalid andtherelevantcomponentsofthemodelformulationaredescribedinthefollowingsection.

3.2.1 Salinity-BalanceModelFormulation Component salinity "uxes into and out of the de"ned control volume are determined by multiplying the water (volume) "ux by the corresponding salinity. The components of the water balance model are the lateral and vertical seepage into the CCS, blowdown water (i.e., additional water pumped from other units totheCCS),rainfall(includingrunofffromearthbermsbetweencanals),andevaporation. Thekeyfeatures ofthesalinitymodelareasfollows:

  • The base of the control volume is assumed to be the bottom of the ID and the cooling canals, whose elevationrangesfromapproximately 3 ftfeetNAVDll toapproximately 30 ftNAVD.Theelevation of bottom of the ID is approximately 20 ft NAVD. Sloping sidewalls of the canals in the CCS are takenintoaccountbyexpressingthewater-surfaceareaasafunctionofthewater-surfaceelevation(s) intheCCS.
  • Lateral seepage of water and salt between the L-31E Canal and the control volume is calculated directly from the product of the calibrated hydraulic conductivity and the difference in water-surface elevationsbetweentheL-31ECanalandtheID.
  • LateralseepageofwaterandsaltbetweenBiscayneBayandthecontrolvolumeiscalculateddirectly fromtheproductofthecalibratedhydraulicconductivityandthedifferenceinwater-surfaceelevations betweentheCCSandBiscayneBay.
  • Verticalseepageofwaterandsaltthroughthebottomofthecontrolvolumeiscalculateddirectlyfrom theproductofthecalibratedhydraulicconductivityandthedifferenceinthewater-surfaceelevations intheCCSandthemeasuredandestimatedpiezometricheadsbeneaththeCCS.
  • Evaporation is estimated using Equation2, which uses meteorological data collected from meteoro-logicalstationsinandimmediatelytothenorthandsouthoftheCCS.

llNAVDreferstotheNAVD88datum.

Exhibit 17

31

  • RainfallisestimatedusingNextGenerationWeatherRadar(NEXRAD)precipitationdataprovidedby theSFWMD.Runoffintothecontrolvolumefromearthbermsbetweencanalsisusedasacalibration parameterandisinitiallyassumedtobe50%oftherainfallthatfallsontheberms.
  • Added water from Units 3 and 4 are assumed to be freshwater (non-saline); Unit 5 blowdown salin-ities are adjusted to between 20% and 80% of seawater (35), with the exact percentage used as a calibrationparameter.
  • TheIDcontrolsystemissimulatedtooperateprimarilybetweenthemonthsofJanuaryandJune;with pumpingratesashighas50mgdandaveraging4.5mgdoverthecalibrationperiod.
  • The water-budget model is calibrated "rst by minimizing the errors between the simulated and ob-served storage in the control volume. Parameters adjusted during calibration of the water-budget model included the hydraulic conductivities in the aquifer adjacent to and beneath the CCS, an evap-oration factor that adjusts the coef"cients in the wind function, the amount of runoff that enters the control volume as percentage of precipitation, and the amount of Unit 5 cooling-tower water that is losttoevaporationbeforeenteringtheCCS.Thesalinitymodelusesmeasuredsalinitiesinandaround theCCS.

Calibrated values of the horizontal hydraulic conductivities in the aquifer surrounding the control volume have been found to be in the range of 500-950ft/d, and calibrated values of the vertical hydraulic con-ductivities beneath the control volume have been found to be in the range of 0.1-4ft/d. Vertical hydraulic conductivities beneath the northern discharge canals and beneath the return canals, where it is assumed deeper canals intersect highly permeable material underlying the muck and Miami Limestone Formation, were calibrated to have (higher) vertical hydraulic conductivities of 3.8ft/d and 4ft/d, respectively. Lower vertical hydraulic conductivities of 0.1ft/d were calibrated for the mid-and southern portions of the dis-charge canals, as well as the southern portion of the return canals. Calibration of the salinity model was doneentirelybytheFPLcontractor.

3.2.2 PreviousModelResults The model was run to simulate salinity variations both before the uprate (i.e., before November 2012) and after the uprate (i.e., after May 2013). The results of these model simulations are useful in understanding thesalinitydynamicsintheCCSandaredescribedbelow.

Pre-uprate model results. The salinity model was calibrated for a 22-month pre-uprate period and the results showed an average volume out"ow rate from the CCS of 0.62mgd, with monthly-averaged out"ow ratesrangingfrom 46:6 mgd(October2010)to+52 :1 mgd(September2010)(EcologyandEnvironment, Inc.,2012). Net"owthroughthebottomoftheCCSwasgenerallyoutwardbetweenthedry-seasonmonths of September through February, and inward during the wet-season months. Average in"ow from precipita-tion during the wet season was more than twice that for the dry season. It was reported that vertical "ows intoandoutofthecontrolvolumeweresubstantiallylargerthanlateral"ows.

Post-uprate model results. A second round of salinity-model results was reported for the post-uprate period of June 2013-May 2014 (Ecology and Environment, Inc., 2014). The results showed an average out"ow rate of 3.26mgd, with monthly-averaged out"ow rates ranging from 31:1 mgd (June 2013) to Exhibit 17

32

+19 :6 mgd(July2013). Duringthepre-uprateandinterimoperatingperiod,(September2010toMay2013),

precipitation accounted for 39.4% of in"owing water to the CCS and evaporation accounted for 63.7% of the out"owing water from the CCS. There was an average rate of increase of salt in the CCS during the post-uprate period of 2:2  10 6 lb/d, which was attributed primarily to the combined effects of low rainfall and high evaporation. These model simulations were able to match the summer 2014 rise in salinity from approximately60toapproximately90.

3.2.3 AnalysisofSalinityDynamics The primary drivers of salinity variations in the CCS are rainfall, evaporation, and seepage exchanges be-tween the CCS and the surrounding aquifer. Pumpage from the ID can also in"uence salinity variations in the CCS, but its role is secondary to that of the aforementioned processes. Evaporation increases the salin-ity,rainfallandIDpumpagedecreasethesalinity,andseepageinterchangewiththesurroundingaquifercan eitherincreaseordecreasethesalinitydependingonotherfactors.

Salinity variations under dry conditions. Under conditions of no rainfall (i.e., dry conditions), salin-ity in the CCS is primarily controlled by evaporation, and the salinity in the CCS steadily increases with time. Evaporation removes pure water from the CCS, and the volume of pure water that is evaporated is replenished by the seepage of saline water into the CCS from the surrounding aquifer. Since the CCS is directly connected to the surrounding aquifer, the water surface elevation within the CCS remains close to the water-table elevation in the surrounding aquifer which changes over relatively long time scales (viz.

months)comparedtotheshortertimescales(viz. days,weeks)overwhichsigni"cantsalinityvariationsare observed. Smalldifferencesbetweenthewater-surfaceelevationsintheCCSandthewater-tableelevations intheadjacentaquiferareproportionaltotheseepageinterchangebetweenthesetwobodiesofwater. Over shorter time scales (viz. days) the evaporated volume of pure water is approximately equal to the seepage in"ow volume of saline water, and the volume of water within the CCS remains approximately constant.

ThismechanismresultsinanincreasedmassofsaltinanunchangedCCSvolume,andhenceanincreasein salinity.

Salinityvariationsunderwetconditions. Whenrainfalloccurs(i.e.,wetconditions),salinityisprimarily controlledbythedifferencebetweenevaporationandrainfall. Conditionsunderwhichevaporationexceeds rainfall result in the net removal of pure water from the CCS and the dynamics of salinity variations under this condition are similar to those described previously for evaporation without rainfall. Hence, for time intervals where evaporation exceeds rainfall, the salinity in the CCS can be expected to increase. For time intervals where rainfall exceeds evaporation, there is a net in"ow of (approximately) pure water into CCS thatisequaltothedifferencebetweentherainfallandevaporationvolumes,andthisin"owisapproximately balanced by the volumeof saline waterthat seeps out of the CCS into the surrounding aquifer. The salinity of the seepage out"ow is approximately equal to the salinity of the water within the CCS. This mechanism resultsinadecreasedmassofsaltintheCCSinanunchangedvolume,andhenceadecreaseinsalinity.

SalinityvariationsunderIDpumping. Pumping water from the ID into the CCS has a relatively minor effect on the salinity in the CCS relative to rainfall and evaporation, since the volume of pumped water is relatively smaller and the difference in salinity between the pumped water and the water in the CCS is also lessthanforevaporationandrainfall.

Exhibit 17

33

3.2.4 DemonstrationofSalinityDynamics The mechanism driving salinity changes in the CCS can be demonstrated using the previously calibrated salinitymodel. Thecumulativerainfall,evaporation,seepagein"ow,IDpumpage, andwaterstorage(=net in"ow) within the CCS between September 2010 and April 2014 are shown in Figure 11. It is apparent

Figure11: Waterin"owintoCCS

from Figure 11 that the storage in the CCS remains relatively constant compared with cumulative rainfall, evaporation, ID pumpage, and seepage in"ow. Further, it can be asserted from Figure 11 that the seepage in"owadjuststothedifferencebetweenevaporationandrainfall-plus-ID-pumpagesoastokeepthevolume of water within the CCS approximately constant. The cumulative evaporation and rainfall in Figure 11 show approximately linear trends, with the evaporation trend line showing an average evaporation rate of approximately39mgd,andtherainfalltrendlineshowinganaveragerainfallrateofapproximately21mgd.

Distribution of seepage in"ows and out"ows. Seepage "ow to the CCS does not occur uniformly over the interfaces of the CCS with the surrounding aquifer, and the relative volumes of seepage in"ow over the CCS interfaces are shown in Figure 12. It is apparent from Figure 12 that most of the in"ow is across the East interface (i.e., the interface facing Biscayne Bay), most of the out"ow is across the Bottom interface, relatively lesser volume "uxes occur across of the North, South, and West interfaces, and in"ows and out-

"ows occur across all interfaces to varying degrees. The relative seepage contributions from the different faces are important inasmuch as the salinity in the aquifer adjacent to the East interface tends to be at least as high as the salinity in Biscayne Bay, the salinity in the aquifer adjacent to the Bottom interface tends to beonthesameorderofmagnitudeasthesalinityintheCCS,andlessersalinitiesoccurattheNorth,South, and West interfaces. The salt contributions from the CCS seepage interfaces are shown in Figure 13. It is apparent that the salt "uxes across the East and Bottom interfaces constitute the predominant components ofthesaltbudget,within"uxofsaltprimarilyassociatedwiththeEastinterfaceandef"uxofsaltprimarily associated with the Bottom interface; keeping in mind that both in"ux and ef"ux of salt can occur at these Exhibit 17

34

Figure12: SeepageintoCCSfromaquifer

interfaces. Lesserbutstillsigni"cantsaltin"uxoccursacrosstheSouthinterfaceandviaIDpumping,with much smaller to negligible salt "uxes across the North and West interfaces. It is apparent from Figure 13 thatintheintervalSeptember2013-May2014the"uxofsaltwasprimarilyand(almost)consistentlyinto the CCS from both the East and Bottom interfaces and, with relatively stable water level and volume in the CCS,thisyieldedan(almost)consistentincreaseintheCCSsalinityasdemonstratedbythemeasurements showninFigure14. Sincetheseepagein"uxwasdrivenbythede"citbetweenevaporationandrainfallvol-umes,itcanbeconcludedthattheincreaseinsalinityintheCCSwasduedirectlytotheevaporation-rainfall de"cit causing contemporaneous in"uxes of salinity from both the Bottom and East interfaces. Subsequent to the time period covered by Figure 14, salinity in the CCS during 2014 increased to a maximum daily-averagevalueofapproximately99.OnJanuary1,2015,theaveragesalinityintheCCSwas75,andby April 26, 2015, salinity levels were over 95. From April 27-28, 2015, signi"cant rainfall over the CCS reduced the average salinity to 78, however, salinities subsequently began rising again in the absence of morerainfall(SFWMD,2015).

Lessons learned. The results presented in this section clearly demonstrate that the salinity in the CCS can be expected to rise signi"cantly during prolonged periods without rainfall, and that further controls are necessary to ensure that CCS salinity concentrations do not exceed acceptable levels in the future. In October2015,inresponsetochloridelevelsintheBiscayneAquiferexceedingwater-qualitystandardsasa resultofthehighsalinitiesintheCCS,FPLreachedanagreementwithMiami-DadeCountywhichincludes construction and operation of six wells that would pump water from the CCS into the Boulder Zone of the FloridanAquifersoastoreducethesalinityintheCCS.

4 PumpingWaterfromtheL-31ECanalintotheCoolingCanals

4.1 PumpingPermitandProtocols InAugust2014,SFWMDissuedanEmergencyOrderauthorizingthepumpingofupto100mgdoffreshwa-terfromtheL-31ECanaltotheCCSbetweenAugustandOctober2014,withtheprimarygoalofreducing Exhibit 17

35

Figure13: Saltin"owtoCCS

the temperature in the CCS. Pursuant to this order, FPL conducted emergency pumping between Septem-ber25 and October15, 2014, and as a result the temperature in the CCS dropped by 6.5F, the salinity dropped from 87 to 75, and the algae concentrations reportedly dropped from 1315cell/L on Septem-ber 26, 2014 to 68cell/L on October 27, 2014. After pumping had terminated, algae concentrations again beganincreasing. Alsosubsequenttopumping,thetemperatureintheCCSbegantoriseagainandonApril 27, 2015, the intake temperature in the CCS was 98.2F. A large rainfall event between April 27 and 28, 2015reducedthetemperatureintheCCSto81.3F,however,byMay17,2015,theintaketemperaturehad risen to 94.6F, which was within 10F of the maximum allowable intake temperature of 104F. It was primarily on the basis of these conditions that FPL requested a permit to pump additional water from the L-31ECanalintotheCCS.

2015-2016 Pumping Permit In May 2015, FPL received a permit from the SFWMD to pump up to 100mgd from the L-31E Canal to the CCS, for the purpose of controlling the temperature in the CCS.

Pumping is permitted between June 1 and November 30 in both 2015 and 2016. A limitation stipulated within this permit is that water cannot be withdrawn from the L-31E Canal on any given day until at least 504acre-ft (2:2  10 7 ft3) of water has been diverted from the L-31E Canal to Biscayne Bay for purposes of"shandwildlifepreservation. DiversionofwaterfromtheL-31ECanaltoBiscayneBayoccursthrough structures S-20F, S-20G, and S-21A, which are located upstream of the CCS withdrawal location (at the SouthPumps)asshowninFigure15. Thesethreeupstreamstructuresopenandclosebasedonprescribed water-surface elevations in L-31E Canal at the structure locations, and the open/close stages of these struc-turesaregiveninTable3. Forexample,inthewet-seasonperiodofApril30-October15theS-20F,S-20G, and S-21A structures open when the L-31E Canal stage is at or above 0.67ft NAVD and close when the stage is at or below 0.27ft NAVD. The cumulative discharges from these structures are monitored daily, to ensure that no pumping from the L-31E Canal into the CCS is allowed until the cumulative discharges from these structures exceed the threshold of 504acre-ft. The delivery system consists of a northern and southernpumpstation,wherethenorthernpumpstationpumpswaterfromtheC-103BasinintotheL-31E Exhibit 17

36

Figure14: MeasuredandmodeledsalinityvariationsinCCS

Table3: GateOperationRulesthatAffectL-31EWithdrawals

L-31EStage Open Close Gate(s) Season Period (ftNAVD) (ftNAVD)

S-20F,S-20G,S-21A Wet April30-October15 0.67 0.27 S-20F Dry October15-April30 0.13 0.53 S-20G 0.67 0.27 S-21A 0.13 0.53

Canal, and the southern pump station pumps water from the L-31E Canal into the CCS. The operational plansynchronizesnorthernandsouthernpumpingoperationssoastoavertdewateringofwetlandsbetween the twopump stations and adjacent to the L-31E Canal. The operational protocol requires that the northern pumps always be started at least "ve minutes prior to starting the southern pumps, and at the end of each day the southern pumps must be shut down at least "ve minutes before the northern pumps are shut down.

This operational protocol for the pumps ensures that the volume of water pumped daily from the C-103 Basin into the L-31E Canal by the northern pumps exceeds the volume pumped from the L-31E Canal into the CCS by the southern pumps. A particularly important condition of the pumping permit is that FPL is requiredtomonitorthestageintheL-31ECanalbetweenthepumpstoensurethatthereisnodrawdownin the L-31E Canal as a result of the pumping operations. Besides ensuring that there is no L-31N drawdown as a result of pumping, this protocol also ensures that the wetlands adjacent to the L-31N Canal are not dewatered as a result of pumping. Subsequent to beginning of pumping on June 1 2015, the salinity level in the CCS dropped to 70, and subsequent large rainfall events have further reduced the CCS salinity to 60,accordingtoreportssubmittedbyFPLtotheSFWMD.

Exhibit 17

37

Figure15: PumpingfromL-31ECanalintoCooling-CanalSystem

4.2 QuantitativeEffects The change in temperature, T, of the water in the CCS resulting from the addition of a volumeV a water attemperatureT a canbeapproximatedusingtherelation

T = V aV 0 + V a (T a T 0) (9)

where V 0 is the initial volume of water in the CCS, and T 0 is the initial temperature of water in the CCS.

Equation9 is a very approximate relationship which assumes that the added water is well mixed over the CCS,anditneglectsthedifferencesindensityandspeci"cheatbetweenthesalinewaterintheCCSandthe freshwaterbeingadded. Inspiteoftheseshortcomingsandintheabsenceofadetailedheat-balancemodel of the CCS, Equation9 can be used to provide a rough estimate of how the temperature in the CCS might reacttotheadditionwaterfromtheL-31ECanal. If100mgd(=1:337  10 7 ft3/d)isaddedtotheCCSwhich hasavolumeof5:746  10 8 ft3 (assuminganaveragedepthof2.8ft)andtheaddedwaterhasatemperature of75F,thenEquation9canbeappliedusingadailytimesteptocalculatethetemperatureintheCCSinas a function of number of days of continuous pumping for initial temperatures in the range of 85F-100F.

The results of these calculations are shown in Figure 16(a). In a similar manner, the change in salinity, S, in the CCS resulting from the addition water at salinity S a can be estimated using the approximate relationship S = (V a V e)V 0 + (V a V e) (S a S 0) (10)

whereS 0 is the initial salinity in the CCS, andV e is the evaporated volume. Equation10 is an approximate relationship which assumes that the added water is well mixed over the CCS, and it neglects decreases in salinity that would be caused by rainfall. If 100mgd is added to the CCS and the rate of evaporation is 39mgd, then the net rate of freshwater addition to the CCS (i.e., V a V e) is equal to 61mgd (= 8:156 

10 6 ft3/d). Using the same CCS volumeV 0 that is used for calculating the daily temperature changes, T,

Exhibit 17

38

Figure16: Approximateeffectofpumping100mgdontemperatureandsalinityinCCS

and taking the salinity, S a of the water pumped from the L-31E Canal equal to zero, Equation 10 can be used to calculate the salinity in the CCS in as a function of number of days of continuous pumping for initialsalinitiesintherangeof70-100asshowninFigure16(b). TheresultsinFigure16collectively indicate that the sustained addition of 100mgd from the L-31E Canal to the CCS over continuous times on the order of a week to a month (30 days) would be an effective means of reducing the temperature and salinity in the CCS. The environmental effects on the surrounding environment of pumping water from the L-31ECanaltotheCCSarediscussedsubsequently.

Context. Toputavolume"owrateof100mgdoffreshwaterinasocietalcontext,itisnotedthat100mgd isapproximatelytheaveragedailydrinking-waterdemandofonemillionpeople. InthecontextoftheCCS, 100mgdcanbecontrastedwiththeaverageCCSevaporationrateofaround39mgdandalong-termaverage rainfall rate on the CCS of around 21mgd, where both of these averages are computed over the 9/1/2010-5/1/2014timeperiod. IftheCCSwereemptyandweretobe"lledbysupplyingwaterat100mgd,itwould take approximately 43days to "ll the CCS. Although 100mgd is more than twice the evaporation rate, the coolingeffectofaunitvolumeofevaporatedwaterismuchgreaterthanthecoolingeffectofaunitvolume ofaddedliquidwater. Forexample, aunitvolumeofevaporatedwaterwouldcauseatemperaturedecrease of around 50 times the temperature decrease caused by adding a unit volume of liquid water that is 20F cooler than the CCS. Therefore, in thermodynamic terms, the addition of 100mgd of pumped water has approximately the same cooling effect as 2mgd of evaporated water. With regard to salinity, the salinity reduction resulting from the addition of a unit volume of fresh water exactly compensates for the salinity increase caused by a unit volume of evaporated water. Hence, 39mgd of added water would neutralize the salinity-increasecausedby39mgdofevaporatedwater,withtheexcessaddedwatercausingareductionin salinity.

4.3 ModelResults The water-balance and salt-balance models used previously by FPL to simulate the pre-uprate salinity dy-namicsintheCCSwereusedbyFPLtosimulatethepotentialfuturescenarioswithandwithouttheL-31E waterinputsinthesummerof2015and2016. FPLmademinorrevisionsinthemodeltoincorporatedataup throughOctober2014. ThemodelsimulationtopredicttheresponseoftheCCStopumpingwaterfromthe Exhibit 17

39

L-31E Canal started November 1, 2014, and ended November 30, 2016. Two scenarios were simulated at multiplemaximum-allowablewithdrawalrates,whereactualwithdrawalrateswerepredicatedontheavail-ability of water in the L-31E Canal after providing 504acre-ft to Biscayne Bay. Scenario A assumes future conditionsthatarethesameasthoseobservedbetweenNovemberl,2010andOctober31,2012;conditions during this time frame re"ected normal weather patterns. Scenario B assumes future conditions that are the same as those observed between November 1, 2013 and October 31, 2014; conditions during this time re"ected dry weather patterns, and this one-year period was repeated sequentially to produce a two-year predictive simulation. In both scenarios, the conditions observed during the "rst November (2010, 2013) wererepeatedtosimulateconditionsforthelastmonth(November2016)ofthe25-monthpredictivesimu-lation. ScenarioAandScenarioBwereeachrunfourtimesunderdifferentpumpingscenarios: nopumping, 30mgd-maximum, 60mgd-maximum, and 100mgd-maximum and for a two-year time period. Under all pumping scenarios the simulated CCS water levels increased and simulated CCS salinities decreased rela-tive to the base case of no pumping. Greater changes were observed in response to greater pumping rates.

Underallpumpingscenarios,thegreatestincreasesinCCSstageoccurbetweenJune1andNovember30.

Applicationof modelresults. The water-balance and salinity-balance modeling done by FPL in support oftheapplicationforthe2015-2016pumpingpermitfocusedontheeffectivenessoftheL-31Epumpingon reducing salinity, whereas the primary motivation for pumping from the L-31E Canal is actually to reduce temperature. Elevated temperatures in the CCS will affect power-generation while elevated salinities will not,andthereisnotaproportionalcorrespondencebetweenreducedsalinityandreducedtemperature,since temperaturesintheCCSdependonavarietyofotherfactorsbesidesthevolumeofwaterpumpedfromthe L-31ECanal..

4.4 EnvironmentalEffects Environmentalconcernsthathavebeenraisedpreviouslybyothersrelatetoboththediversionoffreshwater fromotherenvironmentalrestorationprojectsthatarecurrentlybeingservicedbytheL-31ECanal,andthe utilizationoffreshwatertodilutehypersalinewater,whichdegradesthequalityandutilityofthefreshwa-ter. Based on available information, it appears that the only environmental projects currently being served directlybytheL-31ECanalistheBiscayneBay"shandwildlifepreservationallocationof504acre-ft,and the maintenance seasonal water levels in support of adjacent wetlands. The permitted pumping operation will not divert the water volume previously allocated to "sh and wildlife preservation, and a pumping pro-tocol will be followed to maintain water levels at their no-pumping levels. With respect to the degradation of fresh water, this degradation will in fact occur, however, the extent of water-quality deterioration and speci"c deleterious impacts on existing water uses have not to date been identi"ed. Aside from these pre-viously raised concerns, some major additional concerns resulting from pumping up to 100mgd from the L-31ECanaltotheCCSaredescribedbelow.

4.4.1 EffectofIncreasedWater-SurfaceElevationsintheCCS Pumping water from the L-31E Canal into the CCS will elevate the average water level in the CCS relative to the water level that would exist without pumping. The magnitudes of water-level increases in the CCS were estimated by FPL using the previously developed and calibrated mass balance model of the CCS, and theresultsofthesesimulationsweresubmittedtotheSFWMDaspartoftheapplicationforthe2015-2016 pumping permit (SFWMD, 2015). Since the water level in the L-31E Canal will be held constant during Exhibit 17

40

pumping operations, the increased water-surface elevations in the CCS are of concern because they will decrease the seaward piezometric-head gradient between the L-31E Canal and the CCS. Furthermore, it is likely that the piezometric-head gradient between the L-31E Canal and the CCS could be reversed from a seaward gradient to a landward gradient. This could produce landward groundwater "ow between the CCS andtheL-31ECanal,whichwouldlikelyadvectasalineplumefromtheCCStowardstheL-31ECanal. In additiontotheaforementionedoutcome,elevatedwaterlevelsintheCCSresultingfrompumping100mgd fromtheL-31ECanalwillincreasethe(seaward)piezometric-headgradientbetweentheCCSandBiscayne Bay,resultingintheincreaseddischargeofhigher-salinitywaterfromtheCCSintotheBayviatheBiscayne Aquifer.

Relevantdata. Toquantifytheeffectofincreasedwater-surfaceelevationsintheCCSthatwouldoccuras aresultofpumping,theincreasedwater-surfaceelevationssimulatedbyFPLweresubtractedfromhistorical water-level differences between the L-31E Canal and the CCS to yield possible water-level differences un-derthe100-mgdpumpingscenario. Asdescribedpreviously,twoscenariosweremodeled,withScenarioA corresponding to normal conditions and ScenarioB corresponding to dry conditions. Each simulation coveredtwoyears(2015and2016),withpumpingineachyearfromJune1toNovember30. Theincreases inCCSwater-surfaceelevationsoverthewater-surfaceelevationsthatwouldexistintheCCSwithoutpump-ing are given in Table 4 for selected dates (about a month apart) during each of these scenarios. The values

Table4: EstimatedWaterLevelIncreasesinCCS

2015 2016 Day-Month Scenario (ft) (ft) 15-Jun A 0.00 0.23 15-Jul A 0.00 0.55 15-Aug A 0.55 0.40 15-Sep A 0.57 0.40 15-Oct A 0.50 0.60 15-Nov A 0.65 0.60 30-Nov A 0.50 0.45

15-Jun B 0.00 0.00 15-Jul B 0.62 0.50 15-Aug B 0.65 0.70 15-Sep B 0.15 0.10 15-Oct B 0.35 0.30 15-Nov B 0.37 0.55 30-Nov B 0.50 0.65

giveninTable4wereestimatedfromgraphicalplotsdevelopedbyFPLaspartofthepermitapplication. It is apparent from Table 4 that water-level increases in the CCS on the order of 0.5ft are predicted to occur as a result of pumping water at a rate of 100mgd from the L-31E Canal into the CCS. These water-level increases can be contrasted with historical differences in the water levels between the L-31E Canal and the CCS for the pre-uprate (June 2011-May 2012) and post-uprate (June 2013-May 2014) periods as shown in Table 5, where a positive difference indicates that the water level in the L-31E Canal is higher than the Exhibit 17

41

water level in the CCS. It is apparent from Table 5 that the historical differences between the water levels

Table5: HistoricalWater-LevelDifferencesBetweenL-31ECanalandCCS

Pre-Uprate Post-Uprate Day-Month (ft) (ft) 15-Jun 0.32 0.46 15-Jul 0.57 0.37 15-Aug 0.80 0.40 15-Sep 0.42 0.48 15-Oct 0.85 0.60 15-Nov 0.51 0.49 30-Nov 0.55 0.45

in the L-31E Canal and the CCS are typically on the same order of magnitude as the expected increases in the CCS water level, and therefore a signi"cant impact on the historical seaward water-level gradient is to be expected. This concern is further ampli"ed when it is considered that a minimum water-level difference of 0.30ft is required to keep an acceptable seaward water-level gradient and to keep from triggering the interceptorditch(ID)pumps. IftheIDpumpsareturnedon,thiswouldfurtherelevatethewaterlevelinthe CCSandfurtherdecreasethewater-leveldifferencebetweentheL-31ECanalandtheCCS.

Demonstrationofeffects. Theincreasesinthewater-surfaceelevationsintheCCSpredictedbytheFPL mass-balance model can be subtracted from the historical water-level differences between the L-31E Canal and the CCS to estimate the water-level differences between the L-31E Canal and the CCS that are likely to exist as a consequence of pumping a maximum of 100mgd from the L-31E Canal into the CCS. These expectedwater-leveldifferencesaresummarizedfortheScenarioA(thenormalcondition)inFigure17(a),

and for ScenarioB (the dry condition) in Figure 17(b). For each historical period (pre-uprate and post-uprate), and for each selected day, three water-level differences are shown: the historical difference (blue),

the projected 2015 difference (orange), and the projected 2016 difference (gray). In general, the 2015 and 2016 projected water-level differences are less than the historical differences by the amounts listed in Table 4. Also shown in Figure 17 is the 0.30-ft reference line, which is the threshold water-level difference belowwhichtheIDpumpsystemistriggered. ItisapparentfromFigure17(a)thatunderpre-upratewater-level-differenceconditionsalandwardwater-levelgradientwouldbecreatedaround15-Sepand15-Novon whichdatestherewerepreviouslyseawardwater-levelgradients;the15-Jundatapointisanomalousinthata landwardgradientalreadyexistedinthehistoricalrecord. ItisfurtherapparentfromFigure17(a)thatunder post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov on which dates there were previously seaward gradients. Under bothhistoricalconditions(pre-uprate, post-uprate)showninFigure17(a), thedifferencebetweenthewater level in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all of the dates cited in Figure17(a). ConsideringScenarioB(thedrycondition)showninFigure17(b),theresultsaresimilarto thoseshowninFigure17(a). Underpre-uprateconditions,alandwardwater-levelgradientwouldbecreated around 15-Sep and 15-Nov, and under post-uprate water-level-difference conditions a landward water-level gradient would be created around 15-Jul, 15-Aug, 15-Sep, 15-Nov, and 30-Nov. Under both historical conditions, the difference between the water levels in the L-31E Canal and the CCS would fall below the 0.30-ft threshold on all dates cited in Figure 17(b). The results shown in Figure 17 collectively show that Exhibit 17

42

Figure 17: Differences Between L-31E Canal and CCS Water Levels. The historical difference is in blue, theprojected2015differenceisinorange,andtheprojected2016differenceisingray.

thereiscauseforconcernthatpumping100mgdfromtheL-31ECanalintotheCCScouldcausealandward water-level gradient where none previously existed. This concern is further exacerbated when considering that water levels at the northern end of the CCS near the discharge from the power-generating units will be higher that the average water level in the CCS that is used in this analysis, which further decreases the seawardwater-levelgradientbetweentheL-31ECanalandtheCCS.Concernisfurtherheightenedwhenthe increased density of water in (and under) the CCS is taken into account, since the difference in equivalent freshwater (piezometric) heads between the L-31E Canal and the CCS is less that the difference in water levels between the L-31E Canal and the CCS. It is actually the difference in equivalent freshwater heads that govern the "ow between these bodies of water (e.g., Post et al., 2007). This latter point is particularly importantsincethedifferenceinfreshwaterheadsbetweentheL-31ECanalandtheCCSwillincreasewith depth.

Effectofgeneratingalandwardgradient. Alandwardgradientinthefreshwater-equivalentpiezometric head between the L-31E Canal and the CCS would advect saline water from the CCS towards the L-31E Canal. Such gradients are likely to be generated under 100-mgd pumping operations. Also, since pumping Exhibit 17

43

would be occurring mostly during the wet season, it is likely that a seaward head gradient would exist (and be maintained) west of the L-31E Canal. As a consequence of a landward gradient in the freshwater-equivalent piezometric head east of the L-31E Canal and a seaward (freshwater) head gradient west of the L-31E Canal, it is possible that a saline circulation cell is developed in which water is pumped from the L-31E Canal into the CCS, water seeps out of the CCS and "ows through the Biscayne Aquifer back into theL-31ECanal,andthenthiswaterispumpedbackintotheCCS.Thiscirculationcellwouldincreasethe salinity in the L-31E Canal, which would degrade the quality of the water in the L-31E Canal and decrease theeffectivenessofthepumpedwaterindecreasingthesalinityintheCCS.

Historical anecdote. Interestingly, in 1978, engineers from the consulting "rm Dames and Moore wrote a report to FPL with a speci"c section in their report titled Effects of an Overall Increase in Water Level in the Cooling-Canal System Relative to the Ground Water (Dames and Moore, 1978). In their report, the engineers at Dames and Moore speci"cally considered the impact of raising the water level in the CCS by 0.50ft above the water table in the surrounding aquifer. They concluded that such an occurrence would cause the saltwater interface to move approximately one mile further inland relative to its location prior to theriseinthewaterleveloftheCCS.

4.4.2 SuggestedPermitModi"cations Based on the concerns described here, along with the supporting analyses provided, it is recommended that the pump-operation protocol associated with the 2015-2016 pumping permit be modi"ed to include measurement of water levels in the CCS, and that a threshold water-level difference between the L-31E Canal and the CCS be determined by the SFWMD and added as a controlling factor in pump operations.

To ensure that a subsurface circulation cell of saline water does not develop, the salinity of the water in the L-31ECanalshouldbemonitoredduringpumpoperations.

5 ConclusionsandRecommendations

This brief study consisted of reviewing and summarizing the relevant data and reports relating to the oper-ation of the cooling-canal system (CCS) at the Turkey Point power station, and focusing on three primary issues: (1) the temperature dynamics in the CCS, (2) the salinity dynamics in the CCS, and (3) the impacts andconsequencesofpumpingamaximumof100mgdfromtheL-31ECanalintotheCCS.

Temperaturedynamics: TemperaturedynamicsintheCCSareaconcernprimarilybecauseoperationof the power-generating units will be impacted if the temperature of the cooling water at the intake exceeds 104F. Recentelevatedtemperatureshavecomeclosetoexceedingthisthresholdvalue. Understandingthe temperature dynamics in the CCS is not possible without the development of a heat-balance model of the CCS, and no such model currently exists in the public domain. As part of this study, a preliminary heat-balance model wasdevelopedand is described in this report. Using this model to simulate the heat balance intheCCSduringtheinterval9/1/10-12/7/14showedthatthereweretwodistinctperiodsduringwhichthe heat-rejection rate from the power plant remained approximately constant. The "rst period corresponded to pre-uprate conditions and the second period corresponded to post-uprate conditions. The heat-rejection rate during the second period was found to be signi"cantly greater than the heat-rejection rate during the "rst period. This "nding is not inconsistent with the condition that the post-uprate generating capacity of Exhibit 17

44

the power-generating units served by the CCS is less than the pre-uprate generating capacity, since in the post-uprategeneratingcapacitythereisasigni"cantshiftfromfossil-fuelgenerationtonuclear-powergen-eration, and nuclear-power units are known to have a much higher heat-rejection rate to cooling water than fossil-fuelgeneratingunits. Theincreasedheat-rejectionrateinthepost-uprateperiodwasmanifestedinthe CCSbyincreasedtemperatures. Notably,theaveragetemperatureinthedischargezoneincreasedbyabout 6.3F(3.5C)andtheaveragetemperatureintheintakezoneincreasedbyabout4.7F(2.6C). Considering that the increased average temperature in the intake zone of the CCS is slightly greater that the increased thresholdtemperatureof4.0F(2.2C)approvedbytheNRCin2014,andalsoconsideringthatsupplemen-tary cooling of the CCS was needed in 2014, then caution should be exercised in further increasing power generationbeyond2014levelswithoutareliablesystemtoprovideadditionalcoolingbeyondthatcurrently being provided by the CCS. A power-generation increase would likely lead to a repeat of the need for sup-plementary cooling that was experienced in 2014. There are also indications that the thermal ef"ciency of theCCShasdecreasedinthepost-uprateperiodrelativetothethermalef"ciencyinthepre-uprateperiod. A sensitivity analysis indicated that increased algae concentrations in the CCS and increased air temperatures areunlikelytohavebeenofsuf"cientmagnitudetocausetheelevatedtemperaturesthathavebeenmeasured intheCCS.Inquantitativeterms,theadditionalheatingrateintheCCScausedbythepresenceofhighcon-centrations of algae is estimated to be less than 7% of the heat-rejection rate of the power plant, hence the relatively small effect of algae-induced additional heating. The preliminary "ndings of this study will need to be followed up by further development of the thermal model supplemented by indirect measurements of heat-rejection rates, and (ideally) "ows and temperatures within the CCS, that can be used to calibrate the model within each of the four zones of the CCS. The development of any engineered system to control temperaturesintheCCSwillneedtobedoneintandemwiththermal-modelsimulations.

Salinity dynamics: Salinity in the CCS is a concern because increased salinity levels contribute to the increasedsalinityintrusionintotheBiscayneAquifer. Althoughaninterceptor-ditchsalinity-controlsystem is in place, this system is ineffective in controlling salinity intrusion at depth, and so elevated salinities in the CCS remain a problem. This study con"rms that long-term salinity increases in the CCS are caused by evaporation rates exceeding rainfall rates. Without any intervention, the trend of increasing salinity would continue into the future. Recent spikes in salinity in the CCS are a normal consequence of a prolonged rainfall de"cit and can be expected to recur. Engineered systems that add less-saline water to the CCS to decreasesalinitycouldhaveanadverseenvironmentalimpactcausedbytheincreasedwater-levelelevations in the CCS that these systems create. The effectiveness of an engineered system that pumps saline water fromtheCCStodeep-well(s)fordisposalwilldependonthegroundwater-"owresponseintheaquifersur-rounding the CCS, the induced salinity-transport dynamics within the aquifer, and the operational protocol ofthedeep-wellinjectionsystem. Theinvestigatorwasmadeawarethroughpressreportsthatsuchadeep-wellinjectionsystemhasbeenapprovedforimplementation,however,nosupportingdetailswereprovided byMiami-DadeCountytotheinvestigatorforfurtherconsiderationduringthisstudy.

Pumping from the L-31E Canal: Pumping of up to 100mgd from the L-31E Canal into the CCS is permitted between June 1 and November 30 during 2015 and 2016. Mass-balance modeling has shown that this level of pumping will likely raise the average water level in the CCS by around 0.5ft, and since the historical water-level differences between the L-31E Canal and the CCS are also on the order of 0.5ft, it is likely that there will be a signi"cant reduction, or even reversal, of the historical seaward water-level gradient that would exist in the absence of pumping. It is even more likely that the water-level difference betweentheL-31ECanalandtheCCSwillbereducedbelowthe0.30-ftthresholdthatnormallytriggersthe Exhibit 17

45

IDsalinity-control system. Model results showa likelyreversalof gradient under some circumstances, and a consequence of this reversal could be the advection of a saline plume from the CCS to the L-31E Canal which would cause in increase in the salinity in the L-31E Canal, which is undesirable since the L-31E Canalisregardedasasourceoffreshwaterinitsvariousenvironmentalfunctions.

Recommendedactionitems. Basedontheaforementioned"ndings,thefollowingactionitemsshouldbe considered:

  • Develop a calibrated heat-balance model to simulate the thermal dynamics in the CCS. Essential additional measurements that are required to supplement the calibration of this model are synoptic measurements of volumetric "ow rate through the power-generating units, intake temperature, and discharge temperature. Desirable additional measurements include synoptic measurements of the volumetric "ow rate and temperature into and out of each CCS zone. The thermal model could be developed to simulate the effects of various supplementary cooling systems to support operation of theCCS.
  • Con"rm and identify causative factors for the decline in the thermal ef"ciency of the CCS between thepre-uprateandpost-uprateperiods.
  • Develop a quantitative relationship for estimating algae concentrations as a function of temperature, salinity,andnutrientlevelsintheCCS.Sucharelationshipcouldbederivedusingdatathatisalready being collected. The developed model could be useful in managing the CCS, since algae concentra-tionsaffecttheheatbalanceandpossiblythethermalef"ciencyoftheCCS.
  • Develop a locally validated relationship between the evaporation rate, water temperature, air temper-ature, wind speed, salinity, and algae concentrations in the CCS. This is justi"ed since evaporation is the major cooling process in the CCS, and the evaporation model that is currently being used has a high uncertainty level. At present, a constant in the evaporation function is used as a calibration parameter in the salinity-balance model which is not a desirable circumstance given the importance oftheevaporationprocess.
  • The operational protocol associated with the 2015-2016 permit for transferring up to 100mgd from the L-31E Canal to the CCS should be modi"ed to include: (1) measurement of water levels in the CCStoprecludealandwardequivalentfreshwaterheadgradientbeingdeveloped,(2)speci"cationof thresholdwater-leveldifferencebetweentheL-31ECanalandtheCCSasacontrollingfactorinpump operations,and(3)monitoringofthesalinityofthewaterintheL-31ECanalduringpumpoperations toensurethatCCSwaterisnotseepingintotheL-31ECanal.

The scope of this study was necessarily limited by the short (120-day) time frame that was available to in-vestigatealloftherelevantissues. Follow-onandmoredetailedinvestigationswilllikelyleadtoaresolution ofoutstandingissuesandthedesignofrobustengineeredsystemstocontrolthetemperatureandsalinityin the CCS, as well as the extent of salinity intrusion associated with the operation of the CCS. All of these objectives can likely be accomplished with the goal of having sustainable power generation at the Turkey Pointstation.

Exhibit 17

46

References

[1] Adams, E., D. Harleman, G. Jirka, P. Ryan, and K. Stolzenbach. 1975. Heat disposal in the water environment. -. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources and Hydrody-namics,MassachusettsInstituteofTechnology.

[2] Brady,D.,W. Graves,andJ. Geyer. 1969. Surfaceheatexchangeatpowerplantcoolinglakes. Report No.5.Baltimore,MD:JohnsHopkinsUniversityPress.

[3] Brown, L. and T. Barnwell Jr. 1987. The enhanced stream water quality models QUAL2E and QUAL2E-UNCAS: Documentation and Users Manual. - EPA/600/3-87/007. Athens, Georgia : U.S.

EnvironmentalProtectionAgency.

[4] Byers,H.,H. Moses,andP. Harney1949. MeasurementofRainTemperature.JournalofMeteorology 6:51-55.

[5] Chapra,S.1997. SurfaceWater-QualityModeling. NewYork,NewYork: McGraw-Hill,Inc.

[6] Chin,D.2013. Water-QualityEngineeringinNaturalSystems. Hoboken,NewJersey: JohnWiley&

SonsSecondedition.

[7] Cogley, J. 1979. The Albedo of Water as a Function of Latitude. Monthly Weather Review 107:775-781.

[8] DamesandMoore1971. GeohydrologicConditionsrelatedtotheConstructionofCoolingPonds.

[9] Dames and Moore 1977. Handout, January 1977 FCD/FP&L Semi-Annual Meeting, G-Series Wells MonitoringProgram,TurkeyPoint,FloridaFloridaPower&LightCompany.

[10] Dames and Moore 1978. Salinity Evaluation Turkey Point Cooling Canal System Florida Florida Power&LightCompany.

[11] Ecology and Environment, Inc. 2010. Florida Power & Light Company Semi-Annual Report for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[12] Ecologyand Environment, Inc. 2011a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[13] EcologyandEnvironment, Inc. 2011b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[14] Ecology and Environment, Inc. 2012. Pre-Uprate Monitoring Report for Units 3 & 4 Uprate Project.

-.: PreparedforFloridaPower&LightCompany.

[15] Ecologyand Environment, Inc. 2012a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[16] EcologyandEnvironment, Inc. 2012b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

Exhibit 17

47

[17] Ecology and Environment, Inc. 2012c. Comprehensive Pre-Uprate Monitoring Report for the Turkey PointUnits3&4UprateProject,Section3. -.: PreparedforFloridaPower&LightCompany.

[18] Ecologyand Environment, Inc. 2013a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[19] EcologyandEnvironment, Inc. 2013b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[20] EcologyandEnvironment,Inc. 2014. Post-UprateMonitoringReportforUnits3&4UprateProject.

-.: PreparedforFloridaPower&LightCompany.

[21] Ecologyand Environment, Inc. 2014a. Florida Power&Light CompanySemi-AnnualReport for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[22] EcologyandEnvironment, Inc. 2014b. FloridaPower&LightCompanySemi-AnnualReportforthe TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[23] Ecology and Environment, Inc. 2015. Florida Power & Light Company Semi-Annual Report for the TurkeyPointMonitoringProject. -.: PreparedforFloridaPower&LightCompany.

[24] Fish, J. and M. Stewart. 1991. Hydrogeology of the sur"cial aquifer system, Dade County, Florida.

Water-ResourcesInvestigationsReportNo.90-4108.: UnitedStatesGeologicalSurvey.

[25] FloridaPowerandLightCompany2011. Tenyearpowerplantsiteplan: 2011-2010,Submittedtothe FloridaPublicServiceCommission.Miami,FL,April2011.

[26] GolderAssociates2008. CoolingCanalDataandAnalysisReport.

[27] Hakanson, L. and J. Eklund 2010. Relationships Between Chlorophyll, Salinity, Phosphorus, and NitrogeninLakesandMarineAreas. JournalofCoastalResearch26(3):412-423.

[28] Harbeck, Jr., G. 1955. The Effect of Salinity on Evaporation. Professional Paper No. 272-A. Wash-ington,DC:U.S.GeologicalSurvey.

[29] Howarth,R.andR. Marino2006. Nitrogenasthelimitingnutrientforeutrophicationincoastalmarine ecosystems: Evolvingviewsoverthreedecades. LimnologyandOceanography51(1,part2):364-376.

[30] Martin,J.andS. McCutcheon1998. HydrodynamicsandTransportforWaterQualityModeling. Boca Raton,Florida: LewisPublishers,Inc.

[31] Post, V., H. Kooi, and C. Simmons 2007. Using Hydraulic Head Measurements in Variable-Density GroundWaterFlowAnalyses. GroundWater45(6):664-671.

[32] RayL.LyerlyAssociates1973. ASummaryReportoftheTurkeyPointCoolingCanalSystem.

[33] RayL.LyerlyAssociates1998. ThermalPerformanceoftheCCS.

[34] Ryan,P.andD. Harleman. 1973. Analyticalandexperimentalstudyoftransientcoolingpondbehav-ior. Technical Report No. 161. Cambridge, MA : Ralph M. Parsons Laboratory for Water Resources andHydrodynamics,MassachusettsInstituteofTechnology.

Exhibit 17

48

[35] Salhorta,A.,E. Adams,andD. Harleman1985. EffectofSalinityandIonicCompositiononEvapo-ration: AnalysisofDeadSeaEvaporationPans. WaterResourcesResearch21(9):1336-1344.

[36] Sharqawy, M., J. Lienhard V, and S. Zubair 2010. The thermophysical properties of seawater: A reviewofexistingcorrelationsanddata. DesalinationandWaterTreatment16:354380.

[37] SouthFloridaWaterManagementDistrict2008. SFWMDMemotoFDEP.

[38] SouthFloridaWaterManagementDistrict2015.EmergencyFinalOrderNumber2015-034-DAO-WU.

WestPalmBeach,Florida.

[39] United States Nuclear Regulatory Commission 2012. Location of projected new nuclear power reac-tors.UpdatedMarch2012.Accessed: April2012.

[40] Williams, G. and D. Tomasko 2009. A simple quantitative model to estimate consumptive evapora-tion impacts of discharged cooling water with minimal data requirements. Energy and Environment 20(7):1155-1162.